KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_206940Help
Entry
LOTGIDRAFT_206940 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00600  Sphingolipid metabolism
lgi01100  Metabolic pathways
lgi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    LOTGIDRAFT_206940
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    LOTGIDRAFT_206940
Enzymes [BR:lgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     LOTGIDRAFT_206940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M
Motif
Other DBs
NCBI-GeneID: 20245947
NCBI-ProteinID: XP_009061210
JGI: 206940
UniProt: V3ZZT9
Position
Unknown
AA seq 680 aa AA seqDB search
MFDKMILGILLIAIQAVLTTAVTGDNYVIDASVGFGRTFNGIGAISGGGATSKLLVNYPK
QQQSEILDYLFKPNFGASLHIFKVEIGGDIQSTEGTEASHSHYGWDLDYTRGYEWWMLQE
AKKRNPDIKLYGLPWGFPGWLRDTTDQPWKDIQTTADYVVSWIQGARSKYNLTIDYIGIW
NESPYNVTYIKTLRKTLNKAGFSSTLIIASDQNGWKIAEDMAKDQELSDAIYALGSHYPD
KKSTPLAQQTGKPLWASEDRVDQLARYSILHNKMLSCFTHLGLRALGCRMTLNENYVTGY
MTSTVLWNVVVSYYFGLPWVNSGLMTAREPWSGYYDVRDSIWFTAHTTQFTKIGWKYLKH
DSGAGMLSFGGSYVSLVSPDQQDFTLIIETIRFRSVWFQKCYVFAERNVGEFTFVTVPFF
NIRLSNLHHNRAKQEYFKQLENIPVVDGMVQLQLKDSEVWTLSTISTSFKGYHPNVPEPQ
PFPTTYFEDFEGYNIGEEAYYFSQQIGSFEVASENNNKFMRQIVIDMPVHWFWCHIDNYN
TSLNVFGDYNWSNFTASVSVSVTGENSTDWVFLASRVSAGGCRSLLGTGLFFYFNPKQQQ
YMLTTDLMRNNIIASGGVKNIKSDWNDLELTTNGNTVLGYINSNIVFNVKVPIEILNGWA
AVGTFPYGYAGFDNFLVKKL
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaaaatgatactgggaattttgctgatcgccatacaggctgttttaacaacg
gcagtgactggtgataactatgtaatagatgccagtgtcggatttggaagaacgttcaat
ggaatcggtgccattagtggtggaggggcaacatcgaagttattagtgaattacccaaaa
caacaacagtcagaaatattagattatcttttcaaacccaactttggagcatctctgcac
atatttaaagtggaaatcggaggcgatatccagagtacagagggaaccgaagcttctcac
agccactatggctgggatttagattacaccagaggttatgaatggtggatgctacaagaa
gctaaaaagaggaatcctgatataaaactgtatggattaccatggggattcccgggttgg
ctaagggacacaactgatcagccatggaaagacattcagaccacagcggattatgttgtg
agctggattcagggagctcgttctaagtataatttaaccatcgactatatcgggatctgg
aatgaaagtccgtacaatgtcacctatattaaaactcttcgtaaaactctcaacaaagct
ggatttagctccacgttgatcattgcttctgatcaaaatggttggaaaatagcagaagat
atggcaaaggaccaagaattatcggatgctatttatgctctgggatcccattatccagac
aaaaagagcacgccattggcgcaacaaactggcaaacctttatgggcttcagaagacaga
gttgaccaattagccaggtattcaatattacacaataaaatgttgtcctgttttacccac
ctgggtttaagggccctgggatgtcgaatgacgctgaatgaaaattacgttactggttat
atgacatcgactgtcttatggaatgttgtggtatcgtattattttggtttaccttgggta
aactctggtttaatgacagcaagggagccatggtctgggtattatgatgttagagattca
atttggtttacagctcatacaacccagttcaccaagattggttggaaatatttaaaacat
gatagtggtgctggaatgttatcttttggtggaagttacgtatctttagttagtccagat
caacaggattttactttaatcattgaaacaatacggtttaggtcagtatggtttcagaaa
tgttacgtttttgctgaaaggaatgttggtgagtttacttttgttacagttccatttttc
aatatcagactctcaaatctgcatcataacagagcaaaacaggaatatttcaaacagtta
gaaaatatacctgttgttgatggtatggttcagcttcaactaaaggattctgaggtgtgg
actctcagtactataagtaccagttttaaaggatatcatcccaatgttcctgaaccacaa
ccgtttcctacaacttactttgaagattttgaaggttacaatattggtgaagaagcttat
tatttttcacaacaaatcggttcgtttgaagtagcttctgagaataataataaatttatg
aggcagattgttattgatatgccagtacattggttctggtgccatattgataactataac
acttcattaaacgtatttggagattataattggagtaattttacagctagtgtatctgta
tcggtgactggtgaaaattcaacagattgggtgttccttgcgtctagggtatcagctggt
ggttgtcgttctctccttggtactggtctgtttttctacttcaatccaaaacaacaacaa
tatatgctgacaactgacttgatgagaaataacataatagcatctggcggagtaaaaaat
atcaaatctgattggaatgatttagaattaacaacaaacggcaatacggttcttggttat
ataaactctaatattgtatttaacgtaaaggtaccaatagagattctgaatggctgggca
gcggtcgggactttcccttatggttatgctggattcgacaactttctagtaaaaaagtta
taa

DBGET integrated database retrieval system