KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_218611Help
Entry
LOTGIDRAFT_218611 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00760  Nicotinate and nicotinamide metabolism
lgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LOTGIDRAFT_218611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lgi04090]
    LOTGIDRAFT_218611
   00536 Glycosaminoglycan binding proteins [BR:lgi00536]
    LOTGIDRAFT_218611
Enzymes [BR:lgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     LOTGIDRAFT_218611
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     LOTGIDRAFT_218611
CD molecules [BR:lgi04090]
 Proteins
  LOTGIDRAFT_218611
Glycosaminoglycan binding proteins [BR:lgi00536]
 Hyaluronan
  Cell surface receptors
   LOTGIDRAFT_218611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse
Motif
Other DBs
NCBI-GeneID: 20246793
NCBI-ProteinID: XP_009059574
JGI: 218611
UniProt: V3ZZD5
Position
Unknown
AA seq 292 aa AA seqDB search
MSLFQTAAVLCLVFMVMGNNNPGTTLHLKEIFIGRCWDYKEIKHKEFPLRTDVNCNDLWN
DFYKAFSYQAPCDVAMEHYKEYIDLASQNVPENKGMFWSGTYDIAHEYAEAGKRFVTLED
TMIGFLANSLIWCGSGSTGANFTRCPSWTDCPLESSESFWASASREFASSVNGDVYLMLD
GSRKDKPAYSKDSFFSKYELPALENVNKIVIIVKHNLDGPIKETCSNGSIIDLQEDILNR
GFVFNCLDDPAAIIHLLCADDPEARECKMVNRNESYNTLLPVINSKPSRFNY
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgttccaaacagcagcggttctttgccttgtttttatggtaatgggtaacaac
aatcctggaaccactttacatcttaaagaaatatttattgggagatgttgggattataag
gaaatcaaacataaagaatttccactgagaactgatgtgaattgtaatgatctatggaat
gatttctataaagccttcagctatcaagcaccatgcgatgtagccatggaacattataag
gaatacatagatctcgcctcacagaacgtcccagaaaataagggaatgttttggtcagga
acatatgatatagctcacgagtacgccgaggctggcaagaggtttgtgaccctggaagac
actatgatcgggttcctggcaaacagtttgatttggtgtggttcgggatcaacaggagct
aacttcacaaggtgtccttcatggactgactgtcctctcgaatcaagtgaatctttttgg
gctagtgcctcaagagagtttgcctccagtgtgaatggtgacgtatatttgatgttggat
ggttccagaaaagacaagcctgcttacagcaaagacagtttcttttctaagtatgagcta
ccagctttagaaaatgtgaataagattgttataatagttaaacacaaccttgacggtcct
attaaggaaacgtgtagtaacggttctataatagatctacaagaagatatcttaaacaga
ggatttgtcttcaattgtctcgacgatccagctgcaatcattcatctgttatgcgctgat
gatccggaagccagagagtgtaaaatggtgaataggaacgaatcttacaacacgttactt
ccggtgattaactccaaacctagtagatttaattattaa

DBGET integrated database retrieval system