KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_223188Help
Entry
LOTGIDRAFT_223188 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00561  Glycerolipid metabolism
lgi01100  Metabolic pathways
Module
lgi_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:lgi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LOTGIDRAFT_223188
Enzymes [BR:lgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     LOTGIDRAFT_223188
Peptidases [BR:lgi01002]
 Serine Peptidases
  Family S33
   LOTGIDRAFT_223188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Abhydrolase_2 Abhydrolase_5 Lipase_3 Peptidase_S9 PGAP1 FSH1 Thioesterase DLH LIDHydrolase Ser_hydrolase DP
Motif
Other DBs
NCBI-GeneID: 20247102
NCBI-ProteinID: XP_009066733
JGI: 223188
UniProt: V3ZJJ3
Position
Unknown
AA seq 293 aa AA seqDB search
MSKDGFKNVEACESKIVNTTNQNLFGRYWGEDAEIAQPSGLVFISHGAGEHCLWYNQLAT
QLTDKNLFAFAHDHIGHGQSDGDRVHIDDFDIYVNDVFHHIEIVQKKFPDVPTFIIGHSM
GGAIAIMAGLKRPKFFKGVVLIAPAITPSPDAVQPWKITMGRFLSRLCPQAPILKLDPNN
VSRDEAVVNRYKEDPLVHHGGLKAKWGLCMINTLKYIEDNLSTITFPYLNLHGDQDKLVD
IQGSEDMHEHSTSSDKTFKKYEGYYHQLHNEPGEDGAGVRQEIVTWITDRLPH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagacgggttcaaaaacgttgaggcatgtgaatccaagatagtcaacacgaca
aaccagaatttgttcggtagatattggggagaagatgcggaaatagctcagccaagtggt
ctagtatttattagtcatggtgctggggaacattgtttatggtataatcaacttgctact
caactcacagacaaaaatttatttgcatttgcacatgatcacattggtcatggacaaagt
gatggagatagagtacatatagatgattttgatatttatgtcaatgacgtgtttcaccat
attgagattgtacagaaaaaattccctgatgtccctacatttattattggtcactcaatg
ggaggtgctatagccattatggcagggttaaagagaccaaagttttttaaaggtgttgta
ttaatagctccagctataactcccagtcctgatgctgtacagccctggaagattactatg
ggtagatttttatcacgattgtgtccccaggctcctattttaaaacttgaccctaataat
gtatctagagacgaggcagtggtaaatagatataaagaagatcctttagttcatcatggt
gggctaaaagcaaaatggggattatgtatgataaatacactgaagtatatagaagataat
ctctcaacaataacattcccataccttaatctacatggtgatcaagataaattggtggat
attcagggatcagaagatatgcatgaacattctaccagctcagataaaacttttaaaaaa
tatgagggatattatcatcagcttcataatgaacctggggaagatggtgctggagttcga
caagaaattgtaacatggatcacagacagattaccacattaa

DBGET integrated database retrieval system