KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_239740Help
Entry
LOTGIDRAFT_239740 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00500  Starch and sucrose metabolism
lgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LOTGIDRAFT_239740
Enzymes [BR:lgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     LOTGIDRAFT_239740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fn3-like Glyco_hydro_3_C PTPLA
Motif
Other DBs
NCBI-GeneID: 20251154
NCBI-ProteinID: XP_009050098
JGI: 239740
UniProt: V4A5L0
Position
Unknown
AA seq 212 aa AA seqDB search
MNPRVSAIIAAFYPGQATGIGLLNAMTDHTMPKFGRLPYTWFYSADQVPPIVNYTMVDRT
YRYTTKQPLYPFGYGLTYGIFVYSQLTYKQEINAGDSQSGQVMVANRGEFDADEVVQVYL
KWNSPSVTTQNIQLVDFNRVTLAKNDLAIVKFSIAPQDMAVWTDDKGWVIEEGIISFYVG
GSQPGQPAKRTMRTGIIPGTFQIKGTKILGFN
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaagagtatcagcaattatagctgctttctatccaggacaagctactggtatt
ggtttattaaatgccatgactgatcatactatgcctaaattcggaagattgccctacaca
tggttttattctgccgaccaggtaccaccaatagtcaactatacaatggtagacagaaca
tacagatatacaacaaaacaaccattatatccatttggttatggtttaacttatggtata
tttgtatacagtcagctcacatataaacaagagataaatgctggtgattcacaaagtggt
caggttatggtagctaatcgtggagagtttgatgccgatgaggtcgtacaagtatacctc
aagtggaactctccaagtgtaacgacacaaaatattcaactggtggatttcaacagagta
acattggccaagaacgacttagctatagtgaaattttctatcgcaccacaagacatggct
gtatggactgacgataaaggatgggttattgaagaaggtataataagtttctatgttgga
ggaagtcagccaggacaaccagctaaaagaacaatgagaactggaataataccaggcacc
tttcagattaagggaaccaaaatacttggttttaattga

DBGET integrated database retrieval system