KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_53518Help
Entry
LOTGIDRAFT_53518  CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    LOTGIDRAFT_53518
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lgi01001]
    LOTGIDRAFT_53518
Enzymes [BR:lgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     LOTGIDRAFT_53518
Protein kinases [BR:lgi01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   LOTGIDRAFT_53518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal Haspin_kinase TMEM154 LRR19-TM APH UPAR_LY6_2 DUF753
Motif
Other DBs
NCBI-GeneID: 20251247
NCBI-ProteinID: XP_009064711
JGI: 53518
UniProt: V3Z204
Position
Unknown
AA seq 447 aa AA seqDB search
QCYSSISNTNNVIVKSKGCFDRDSSSQMSCHSKNHVGAVSCCQGNWCNDLLTATLAPLPT
SGKEDENELLLHLPLILAVIIPIIIVSILIPIIVIACRHLHKQRMDELFQRERRLLDEDD
GLRATQVGESTLQEILEQSCTSGSGSGLPFLVQQTVARQVQLHDCIGKGRYGEVWRGSYH
DEPVAVKIFSSRDEASWSRETQIYNTCLLRHENILGYYASDMTSRNSCTQLWLITHYHHH
GSLYDYLISHILSIEEMLTLCLTAAAGLVHMHTEIVGNHGKPAIAHRDIKSKNILVKTNG
TAVIGDLGLAVTHTQEDNVLDFGHNNKVGTKRYMAPELLEETLNPNFFDSFKCVDVYAFG
LVLWEISRRAVVGGFSEDYQIPYWDVVPSDPSFDDMKKVIVTDLQRPTIPNRWSSNEILM
QMTKLMKECWAHNPKARLPMLRVKKTL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
cagtgttattcatctataagtaataccaacaatgttattgttaaaagtaaaggatgtttt
gacagagatagcagcagtcaaatgtcctgtcacagtaaaaatcatgttggtgctgtatcc
tgttgccaaggaaactggtgtaatgatttgttaacagctaccctagctccattaccaacc
agtggaaaagaagatgaaaatgaacttttacttcacctaccgttaatactagctgttata
ataccgattatcatagtcagtatcttaataccgattatagtcatagcctgtcgacatcta
cacaaacaaagaatggatgaactgtttcaacgagaacgcaggctattagatgaagatgat
gggctcagagcaacacaagtgggagaaagcacattacaagaaatattggaacagtcttgt
acttctggtagtggctcaggtcttccatttctggtccaacaaactgtagctagacaagtt
caacttcatgattgtattggtaaaggaagatatggtgaagtgtggaggggatcctatcat
gatgaaccagtggcagtcaaaatcttttcatctcgagacgaggccagttggtcacgtgaa
acacagatatacaacacttgtttattacgacacgaaaacatattgggatactacgcatct
gatatgacgtcacggaattcgtgtacacaactgtggttaataacccattatcatcatcac
ggttctctgtacgattatttgatatcacatatattaagcatcgaagaaatgttaacttta
tgtttgacggctgcagcaggattggttcatatgcatacggaaatagttggtaaccatggg
aaaccagctatagctcatcgagatatcaaatctaaaaatattttggtaaaaaccaatggt
actgctgtaattggagatcttggcctagctgttactcacacacaagaagataatgtatta
gattttggacataataataaagttggtaccaagcgttacatggcgccagagttattggaa
gaaacattaaatccaaatttctttgattccttcaaatgtgtggatgtctatgcttttggt
ttggttttatgggaaatcagtcgaagagctgttgttggaggtttcagtgaagattatcag
ataccatattgggatgttgtgcctagtgatcctagttttgatgacatgaagaaagtgata
gtgactgacttacagagacctactatacctaatagatggtcttctaatgaaattttgatg
caaatgacaaaactgatgaaagaatgttgggctcataatccgaaagctcgtttaccaatg
ttacgtgtgaaaaagacactt

DBGET integrated database retrieval system