KEGG   Lactobacillus gallinarum: AO203_05895Help
Entry
AO203_05895       CDS       T04115                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lgl  Lactobacillus gallinarum
Pathway
lgl00071  Fatty acid degradation
lgl00072  Synthesis and degradation of ketone bodies
lgl00280  Valine, leucine and isoleucine degradation
lgl00310  Lysine degradation
lgl00362  Benzoate degradation
lgl00620  Pyruvate metabolism
lgl00630  Glyoxylate and dicarboxylate metabolism
lgl00640  Propanoate metabolism
lgl00650  Butanoate metabolism
lgl00900  Terpenoid backbone biosynthesis
lgl01100  Metabolic pathways
lgl01110  Biosynthesis of secondary metabolites
lgl01120  Microbial metabolism in diverse environments
lgl01130  Biosynthesis of antibiotics
lgl01200  Carbon metabolism
lgl01212  Fatty acid metabolism
lgl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AO203_05895
   00630 Glyoxylate and dicarboxylate metabolism
    AO203_05895
   00640 Propanoate metabolism
    AO203_05895
   00650 Butanoate metabolism
    AO203_05895
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AO203_05895
   00072 Synthesis and degradation of ketone bodies
    AO203_05895
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AO203_05895
   00310 Lysine degradation
    AO203_05895
   00380 Tryptophan metabolism
    AO203_05895
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AO203_05895
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AO203_05895
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AO203_05895
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgl04147]
    AO203_05895
Enzymes [BR:lgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AO203_05895
Exosome [BR:lgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AO203_05895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALJ23419
UniProt: A0A0P0EM09
Position
1146025..1147185
Genome map
AA seq 386 aa AA seqDB search
MKNIYIVAAKRTPFGKYRGFFKDASAIDLGVMALKGTLKAGNTDPNDVQELFMGNVLSTG
LGENMARQVALNSGMRKESTAATINDVCGSSLKAVRLAQGQMELGDLDLVAVGGSESMTR
APYFVKKENKENPADHLVNTMINDGLMDAFSGQHMGITAESVAQRYHVSREEMDEFSLRS
HKKAAEATKSGFFDNEILPIEINGETLDHDESIRPDTSMAALSQLKPVFKEDGDVTAGNS
SPLTDGASMLVLATEDKVKDLNLKPIAKLGAFAEAGFDPVYMGYTPYFAVKKLLKKTGRS
INDYDIVELNEAFASQSVAVARDLQIPDDRLNIMGGAIALGHPLGATGTRLICSAISGLK
KEQGQRALVTLCIGGGQAIVYEIENI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatttatattgtagcggccaagagaacaccttttggcaagtatcgtggattt
tttaaagatgcttcggcaatcgatcttggtgtaatggcgttaaagggaactttaaaagca
ggaaatactgatcctaatgatgttcaagaacttttcatgggaaatgtgttgagtacaggc
ttaggtgaaaatatggcccgacaggttgctcttaactcggggatgagaaaagaatcaact
gcggcaacgattaatgatgtttgtggctcaagtcttaaggctgttcgtctggctcaaggt
caaatggaactaggcgacctggatttagtcgcagtgggtggtagcgaaagcatgactcgt
gcgccatattttgttaaaaaagagaataaagaaaatcctgcagatcatttagtaaatact
atgattaatgatggtttgatggatgctttttctggacaacatatggggattaccgctgaa
agcgttgctcaaagatatcatgttagtcgtgaagaaatggatgaatttagtcttcgttct
cataaaaaagcggcagaggcaacaaaatccggcttttttgataatgaaattttgccaatt
gaaattaatggtgagactttagatcatgatgaatcaattcgtcctgacacttctatggca
gcattaagccaattaaaacctgtctttaaagaagatggtgatgtgacagctggcaattcc
tcaccgttaacagatggagccagtatgttggtattagccacagaagacaaggttaaagat
ttgaacttaaagccaatcgctaagttaggagcttttgcggaggctggatttgatcctgtt
tatatgggatatacgccatattttgctgtgaaaaaattgcttaaaaagacaggacgttca
attaatgattatgatatcgtggaactaaacgaagcttttgcttcacagagtgtagcagta
gcacgtgatttgcaaattcctgatgatagattgaatatcatgggcggtgctattgcatta
ggacatccgttaggtgctactggaactagattgatttgttctgcaatcagtggcttgaag
aaagagcaaggtcaacgtgcattagtaaccttgtgcattggcggtggccaagcaatcgta
tatgaaatcgagaatatctaa

DBGET integrated database retrieval system