KEGG   Lactobacillus gallinarum: AO203_06485Help
Entry
AO203_06485       CDS       T04115                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lgl  Lactobacillus gallinarum
Pathway
lgl00430  Taurine and hypotaurine metabolism
lgl00620  Pyruvate metabolism
lgl00640  Propanoate metabolism
lgl00680  Methane metabolism
lgl01100  Metabolic pathways
lgl01120  Microbial metabolism in diverse environments
lgl01200  Carbon metabolism
Module
lgl_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AO203_06485
   00640 Propanoate metabolism
    AO203_06485
  09102 Energy metabolism
   00680 Methane metabolism
    AO203_06485
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AO203_06485
Enzymes [BR:lgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AO203_06485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ALJ23515
UniProt: A0A0P0EEL4
Position
1266035..1267219
Genome map
AA seq 394 aa AA seqDB search
MKKVLAINSGSSSFKYKLFSLPDEKVIASGMADRVGLDNASFEIKLADGTKHVEKTEIAD
QEAAVNLLIKFLKQFNVVDDLHEIVGVGHRVVNGGEYFDDSTIITKENLPKIYELEDYAP
LHNPAEGRGIEAFMNVLPEVPQVAVFDTTYHRALDPVHYLYSLPYEYYEKYGVRKYGAHG
TSIRYTAPHAAKMLGKDLKDLKLIICHLGSGASITAVKDGKSYDTSMGFSPIAGITMATR
CGDIDPSLIQHLMHVEGKSMDEMIHILNHKSGLLGLSGISPDMRDVRESDTDRAKLARKI
FINRIVRYVGSYIAEMGGVDAIIFTAGIGEHDMGVRKEVMDAFKYMGVEPDYEANEENGE
HFITKPDSKVKAMVIPTNEELIIERDVVRLTNIN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggttttggcgattaactcaggtagttcatcttttaaatataagttattttca
ttgccagatgaaaaagtgattgcaagtggtatggctgatcgtgttggattggacaatgct
tcttttgaaattaaattggctgacggcactaagcatgtagaaaaaacagaaattgccgat
caagaagctgcagttaacttgttaattaaattcttgaagcaatttaatgtagtagatgat
ttgcatgaaatcgttggcgtgggtcaccgtgtagttaatggtggtgaatactttgatgat
tctactattatcaccaaggaaaatttacctaagatttatgaactagaagattatgctcca
cttcacaacccagctgaaggtcgtggaattgaagcatttatgaatgtattgccagaagta
ccacaagtagccgtgtttgatactacttatcatcgcgctcttgatccagttcactactta
tattctcttccttatgaatactatgaaaaatatggtgttcgcaagtatggtgcacatggc
acatcaatccgctatactgcacctcatgctgctaaaatgctcggcaaagatttaaaggat
ttaaaattaattatttgtcacttaggttcaggtgcttcaattactgctgtaaaagatgga
aaatcgtatgacacttcaatgggctttagtccaattgctggtatcacaatggcaactcgt
tgtggtgatattgacccatcacttattcaacatttaatgcatgttgaaggaaaatccatg
gatgaaatgattcatatcttgaatcacaaatctgggctgcttggcttatcaggtatttct
ccagatatgcgtgacgtccgtgaaagcgacacagaccgtgctaaacttgcaagaaagatt
tttattaatagaatcgttcgttacgttggttcatatattgctgaaatgggcggcgttgat
gctattatctttactgctggcattggtgaacatgatatgggcgtacgtaaggaagttatg
gatgctttcaagtacatgggtgttgaaccagattatgaagcaaacgaagaaaacggtgag
catttcattactaagccagattctaaggtgaaggcaatggttattccaactaatgaggaa
ttaatcattgaacgtgatgtagttcgtttgactaacattaattaa

DBGET integrated database retrieval system