KEGG   Lactobacillus gallinarum: AO203_11535Help
Entry
AO203_11535       CDS       T04115                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lgl  Lactobacillus gallinarum
Pathway
lgl00670  One carbon pool by folate
lgl01100  Metabolic pathways
lgl01120  Microbial metabolism in diverse environments
lgl01200  Carbon metabolism
Module
lgl_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lgl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AO203_11535
Enzymes [BR:lgl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     AO203_11535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ALJ24315
UniProt: A0A0P0EGL4
Position
complement(2281286..2282947)
Genome map
AA seq 553 aa AA seqDB search
MPTDIEIADAAKVQPITEIAQKLGLSADDIEQYGHYKAKINLPVKEVAGKKHKLILVTGI
NPTSAGEGKTTVLVGLGDALNQLGYQTTIAMREPSMGPVFGIKGGATGGGYSQLVPMEDI
NLHFTGDMHALTSANNTLAALIDNYIMRDNALGLDPRRIIWKRVEDVNDRALRNVVTGLG
GIMQGVPRETGFDITAASEMMAILCLSKNLHDLKKRIGRIVVGYTYAKEPVTVDQMGFTG
AITLLLKDAIKPNLVQTLDHTPAIVHGGPFANIAHGCNSVLATQIAVNTSDYTVTECGFG
ADLGAEKFLDIKRPVLGKTPNAVVIVATCRALKLNGGADKNNLTQENITALEKGMANLCR
HIRNMQNYNLPIVVAINHFTGDTEAEIKAIQAACAKLNVKAVKVDAWAKGGQGTQDLARE
VVQLATEKLEFHELYQNSDSIKDKLTAIATKIYGAKEVILSKKAQKQLKTFDKQGWNNLP
VCIAKTQYSFTDDQTKLGAPTDFDFHIRSFVPKLGAGFIVALSGTMMTMPGLAKHPAAEN
MDIDDQGKITGLF
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccgacattgaaattgcagatgctgccaaagtgcaacctataactgaaattgcc
caaaaactaggcttgtctgctgatgatattgaacaatatggtcattataaagccaagatc
aacttgcctgttaaagaagttgcgggtaaaaagcataaattgattttagttactggaatt
aatcctacttctgcaggtgaaggaaaaaccactgttttagttggcttaggggatgcacta
aaccaattaggatatcagactacaattgctatgcgtgaaccatcgatgggccctgttttt
ggaattaaaggtggtgcaaccggtggtggttatagtcaattggtaccaatggaagatatt
aacttacactttactggagatatgcatgctttaacgtctgccaacaatactttagctgct
ctgattgataactatatcatgcgtgataatgctttaggactagatccacgcagaattatt
tggaagagagtcgaagatgtaaacgatcgtgctctaagaaatgtagttactggactaggc
ggtattatgcaaggtgttcctagagaaaccggctttgatattactgcagcttcagaaatg
atggctattctttgtttatccaagaatcttcatgatttgaagaaaagaattgggcgtatt
gtagttggttatacctatgctaaagagcctgttactgttgatcaaatgggctttactggt
gcaattacgcttttattaaaagatgctatcaaaccaaacttagttcagactttagatcat
actccggctattgttcatggcggaccttttgccaatattgctcatggctgtaattcagtt
ttggctactcaaattgcagtgaacacttctgattacacagtcacagaatgcggtttcggt
gccgatttgggtgctgaaaaatttttagacatcaagcgtcctgttttaggtaaaacgcca
aatgcggttgtgattgttgcaacttgccgtgctcttaaacttaacggtggtgctgacaag
aacaatttaactcaagaaaatattacagccttggaaaaagggatggccaatttatgcaga
catattagaaatatgcaaaattataatttgccaattgttgttgcgattaatcattttact
ggtgacactgaagcagagataaaggctattcaggctgcttgtgcaaaattaaacgttaag
gctgttaaagttgatgcttgggctaaaggtggacaaggtactcaggatttagccagagag
gttgttcaacttgccactgaaaaattggaatttcatgagctatatcaaaattcagattca
attaaggataaattaacggctattgccactaagatttatggagccaaagaggtgattttg
tctaagaaggcacagaaacaattaaaaacttttgataagcaaggatggaataatttgccg
gtatgtattgccaaaacacagtattcatttacggatgatcaaacaaaattaggagctcct
actgattttgactttcatattcgttccttcgtgccgaagttgggtgccggattcatagtt
gccttgtccggtaccatgatgacaatgccgggtttggcaaaacatccagcagctgaaaat
atggatattgatgatcaaggcaaaatcacaggattattttaa

DBGET integrated database retrieval system