KEGG   Lactobacillus ginsenosidimutans: ABM34_05745Help
Entry
ABM34_05745       CDS       T03990                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lgn  Lactobacillus ginsenosidimutans
Pathway
lgn00450  Selenocompound metabolism
lgn00970  Aminoacyl-tRNA biosynthesis
lgn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ABM34_05745
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ABM34_05745
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lgn01007]
    ABM34_05745
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lgn03016]
    ABM34_05745
Enzymes [BR:lgn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ABM34_05745
Amino acid related enzymes [BR:lgn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ABM34_05745
Transfer RNA biogenesis [BR:lgn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ABM34_05745
 Prokaryotic type
   Other AARSs
    ABM34_05745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF2833
Motif
Other DBs
NCBI-ProteinID: AKP67090
UniProt: A0A0H4R054
Position
complement(1074980..1077001)
Genome map
AA seq 673 aa AA seqDB search
MTNGDKKTFYITTPIYYPSGKLTIGNSYTTIAADTLARYKRAEGFDVFFLTGTDEHGLKI
EEKAEANKMQPQEYVDMMAAKIKDLWKLLEISNDKFIRTTDDYHVKAVQNIVERLIKSGD
VYLGEYSGWYSVDDEEYFTESQLAEVYRDKDGKVIGGKAPSGHEVSLVKEPSYFFRMSKY
ADRLLKYYEDNPTFIEPEIRKNEMINNFIKPGLEDLAISRTTFNWGVPIPSNPKHVVYVW
IDALLNYITALGYETDDDSLFQRYWPANVQFVGKEIVRFHTIYWPIVLMALGIDLPKQVF
GHGWLLMKDGKMSKSKGNVVYPEMLVERYGLDSLRYYLMRAMPFGNDGVFTPEDYVDKIN
YDLANDLGNLLNRTISMINKYEGGKVTTVDDVSDFDKSLVEASKQAVTEYREHMDKFEFP
DALASVWAFIGRANKYIDETKPWILAKDPEGKAELASVLGHLVESLRLIALMISPVMTQS
PKKIFAQLGLDIDKDTELAFGKTSVGTTVTDDPQPIFPRLDADEEVAYIKGKMAEEQAKH
GAGKLSKSAQAKAKAQADEDGDYPKEIEYDDFAKVKMVVCEILDVKRVANADKLLQFKLD
DGSGIDRQILSSIYEFYPDYEKLIGKKVIAVTNLKPRKIRGEWSNGMLLSSEKGDDVILA
TVDNSHKNGAILS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgactaacggtgacaaaaaaacattttacataactacaccaatttattacccatcaggt
aaattaactatcggtaactcatatacaacgattgctgccgatactttggcacgttacaaa
cgtgctgaaggatttgacgttttcttcctaacaggtaccgacgaacatggacttaagatt
gaagaaaaagctgaagcaaacaagatgcaacctcaagaatacgttgatatgatggctgca
aaaatcaaagatctctggaaattattagagatttcgaatgacaaatttattcgaacaact
gacgattatcacgttaaggctgttcaaaacattgttgaacgtcttatcaaatcaggagac
gtttatttaggtgagtattcaggttggtattcagttgatgacgaagagtatttcactgaa
tcacaattagctgaagtttatcgtgataaagatggcaaagttatcggtggtaaggctcca
tcaggtcacgaagtttcactagttaaggaaccttcatacttctttagaatgagtaaatat
gctgatagattattgaagtattacgaagataatccaacattcattgaacctgaaattcgt
aagaatgaaatgattaataactttatcaaaccaggtttggaagatttagctatttctaga
acgactttcaactggggtgttccaattccaagtaatcctaagcatgttgtttatgtttgg
attgatgctttgttgaactatattacagctttaggatatgaaactgatgatgattcattg
ttccaacgttattggcctgctaatgttcaatttgtcggtaaggaaattgtcagattccat
actatttattggccaattgttttgatggcattagggattgatttaccaaaacaagttttc
ggccacggatggttgttgatgaaagacggtaaaatgtctaagtctaaaggtaatgttgtt
tatcctgaaatgttggttgaacgttatggccttgattcattacgttattacttaatgcgt
gcaatgccatttggtaacgatggtgtcttcactccagaagactatgttgataagataaat
tatgatttagcaaatgaccttggaaacttgttgaacagaactatttctatgattaacaag
tatgaaggcggaaaagttaccacagttgacgatgtttctgattttgataagagcttggtt
gaggcttcgaaacaagctgttacagaatatcgtgaacacatggataagtttgaattccct
gatgcacttgctagtgtctgggcatttattggacgtgcaaataaatatattgatgaaact
aaaccttggattttggcaaaagatcctgagggcaaggctgaactagcttcagttcttggt
cacttggttgaatcattacgattgattgctttgatgattagtcctgttatgacacaatca
ccaaagaaaattttcgcgcaattgggcttggatattgataaagatactgaattggcattt
ggtaaaacttctgttggaaccacagttacagatgatcctcaacctattttccctcgactt
gatgctgacgaagaagtagcatacatcaaaggtaaaatggcagaagaacaagctaagcat
ggtgctggtaagttgagtaaatctgcccaagctaaagccaaggcacaagctgatgaagat
ggcgattatcctaaagaaatcgaatatgatgactttgcaaaagttaagatggttgtctgt
gagattcttgatgttaaacgagttgctaacgcagacaagcttctccaattcaaactggac
gatggttcaggaattgatcgtcaaattctatcaagcatttatgaattctatccagattac
gaaaaactaattggtaagaaagtcattgctgttactaatttgaagcctagaaagattcgt
ggcgaatggagtaacggtatgctattgtcatcggaaaaaggtgacgatgtaatcttggca
acagttgataattcacacaaaaatggagcaatcttaagctaa

DBGET integrated database retrieval system