KEGG   Lactobacillus ginsenosidimutans: ABM34_08345Help
Entry
ABM34_08345       CDS       T03990                                 

Definition
(GenBank) sugar aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lgn  Lactobacillus ginsenosidimutans
Pathway
lgn00051  Fructose and mannose metabolism
lgn01100  Metabolic pathways
lgn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lgn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ABM34_08345
Enzymes [BR:lgn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     ABM34_08345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AKP67536
UniProt: A0A0H4QKE7
Position
1623208..1623981
Genome map
AA seq 257 aa AA seqDB search
MKMMFQTEREDLANTVRKMFDRKDTNIAGGNMSVKVFDKEDHPYILLTPTFMSETFFAEL
SPAQILVIDGITYEKIDGVGDVTREVNMHERAYTAHPGIRCVYHSHAPKAMFWATSGLDM
PNVTEVTRELGDIKCLPYAPACSQALADTVYDELIKIGDKAMENIFLLNSHGILITATDL
HVATRVMETVEWNAEIAYQQQVFIKLGLLPDYQSCGANYKEPVPEGSLPAIPLPEINKVA
YEHPFPENIARPNEEVY
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgatgtttcaaacagaaagagaagatttagctaacacagttagaaaaatgttc
gatagaaaagacacaaatattgctggaggaaacatgtcagtgaaagtcttcgataaagaa
gaccatccctacattctattaactcccacatttatgtcagaaacattcttcgcagaattg
tcaccagctcaaatcctagtaattgatggaattacatacgaaaaaattgacggtgtcggc
gacgtaacacgtgaagtaaacatgcacgaaagagcctatacagctcacccaggcatcaga
tgtgtttaccactcacacgcaccaaaagctatgttctgggcaacatcaggactagacatg
ccaaacgtaaccgaagtaaccagagaactaggagacatcaaatgcctaccatatgctcca
gcatgttcacaagctttagcagatacagtttatgacgaactaatcaaaatcggtgacaaa
gcaatggaaaacatcttcctattgaacagccacggaatactaatcacagcaacagaccta
cacgtagcaacaagagtaatggaaaccgtagaatggaatgccgaaatagcctatcaacaa
caagtattcatcaaattaggcctactacccgattaccaatcatgtggcgccaactacaaa
gaaccagtaccagaaggatcattaccagcaatcccactaccagaaatcaacaaagtagct
tatgagcacccattcccagaaaatattgctcgtccaaatgaggaggtgtactaa

DBGET integrated database retrieval system