KEGG   Lactobacillus ginsenosidimutans: ABM34_11670Help
Entry
ABM34_11670       CDS       T03990                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lgn  Lactobacillus ginsenosidimutans
Pathway
lgn00071  Fatty acid degradation
lgn00072  Synthesis and degradation of ketone bodies
lgn00280  Valine, leucine and isoleucine degradation
lgn00310  Lysine degradation
lgn00362  Benzoate degradation
lgn00380  Tryptophan metabolism
lgn00620  Pyruvate metabolism
lgn00630  Glyoxylate and dicarboxylate metabolism
lgn00640  Propanoate metabolism
lgn00650  Butanoate metabolism
lgn00900  Terpenoid backbone biosynthesis
lgn01100  Metabolic pathways
lgn01110  Biosynthesis of secondary metabolites
lgn01120  Microbial metabolism in diverse environments
lgn01130  Biosynthesis of antibiotics
lgn01200  Carbon metabolism
lgn01212  Fatty acid metabolism
lgn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lgn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABM34_11670
   00630 Glyoxylate and dicarboxylate metabolism
    ABM34_11670
   00640 Propanoate metabolism
    ABM34_11670
   00650 Butanoate metabolism
    ABM34_11670
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABM34_11670
   00072 Synthesis and degradation of ketone bodies
    ABM34_11670
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABM34_11670
   00310 Lysine degradation
    ABM34_11670
   00380 Tryptophan metabolism
    ABM34_11670
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABM34_11670
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABM34_11670
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABM34_11670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgn04147]
    ABM34_11670
Enzymes [BR:lgn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABM34_11670
Exosome [BR:lgn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABM34_11670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt OpuAC
Motif
Other DBs
NCBI-ProteinID: AKP68126
UniProt: A0A0H4QLZ1
Position
2339647..2340801
Genome map
AA seq 384 aa AA seqDB search
MDSVVIIDAKRTAIGKFRGQFANVSSVELGTELVKQLLTNNKINPEDVDQFIFGNVYQSG
MGQNVARQIGINVGGSAKSTAMTVNQVCGSGMKAVHDATNALLLEDADIIVCGGVESMSN
APFYSKRVGKLEVSDEQGDTLFRDGLVDAFGNYPMGITAENVAKRYNVTRQMQDEFSLQS
QKKAFAATDKIADEILPIEVDGKQVVTDQSIRGESTLETMSNLKPAFEENGTVTAGNSSP
LNDGAAAMILMRKKTAEKLGLSYIAELKGYVEAGIDPSIMGYAPYYAINKYYDKYNITQD
QIDYFEINEAFAAQSVAVARDLKIPDDKLNVFGGAIAIGHPLGATGARLIVSLINILQKE
NKKSGIASLCIGGGMGMALGLELS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggattcagtcgttattatagatgccaagagaactgctattggcaaattccgcggtcag
ttcgcaaatgtctcatcagtcgaactcggcacagaactagtaaagcagttattgactaat
aacaaaatcaatccagaagatgtcgatcaattcatttttggaaacgtttatcaatccgga
atgggacaaaatgtcgccagacaaattggtataaacgttggtggtagtgcaaagtcaacc
gccatgacagtcaatcaagtatgtggttcaggtatgaaagctgtgcacgacgcaacaaat
gccttactgctagaagatgccgatatcatcgtttgtggtggtgttgaaagcatgtcaaac
gcacctttttactcaaaacgtgtcggcaagttagaagtttccgatgaacaaggtgataca
ttatttcgagacggattagttgatgcctttggaaattatccaatgggaatcaccgccgaa
aatgttgccaaacgatacaacgtaactcgccaaatgcaagacgagttttctttgcagtct
cagaagaaagccttcgcagcgactgacaaaattgccgatgagatcttgccaattgaagtt
gatggtaagcaagttgtcaccgaccaatcaattcgtggcgaatcaacactcgaaacaatg
tcaaatctcaaaccagcttttgaagaaaacggaacagttaccgccggcaattcctcacct
ctaaatgacggtgcagcagcgatgattttaatgcgtaagaagactgctgaaaaattaggc
ttgtcgtatattgccgaattgaaaggctacgtcgaagctggtattgatccaagtatcatg
ggttatgctccatattatgccatcaacaaatattatgataagtacaatatcactcaagac
caaattgattatttcgaaatcaatgaagcttttgccgcccagtcagtagcagtggctcgt
gacttgaagatacctgatgataagttgaatgtgtttggtggagccattgcaatcggtcat
ccattaggtgcaacaggcgcacgtcttatagtttcactaataaacattttgcaaaaagaa
aataagaaatccggtattgcttcactctgcattggtggaggaatggggatggcgttagga
ctcgaattatcatga

DBGET integrated database retrieval system