KEGG   Lactococcus garvieae ATCC 49156: LCGT_0957Help
Entry
LCGT_0957         CDS       T01618                                 

Definition
(GenBank) D-alanyl carrier protein
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
lgr00473  D-Alanine metabolism
lgr01100  Metabolic pathways
lgr01503  Cationic antimicrobial peptide (CAMP) resistance
lgr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lgr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LCGT_0957
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LCGT_0957
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LCGT_0957
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:lgr01504]
    LCGT_0957
Enzymes [BR:lgr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     LCGT_0957
Antimicrobial resistance genes [BR:lgr01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    LCGT_0957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: BAK58470
Position
985520..985762
Genome map
AA seq 80 aa AA seqDB search
MKNEVLNIIEEVAGTDEFREDLDMDLFEEGILDSMRAIMLIVELENAFSLSLPPSEMDRD
DWNTANKITDRIKEKMDEER
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaagtcttaaatatcattgaagaagttgctggcacagatgagtttcgtgaa
gatttagatatggatctttttgaagaaggcatccttgactctatgagagcaattatgctt
attgttgaacttgaaaatgcctttagtttgagtttaccaccttctgaaatggatcgtgac
gactggaacacagcaaataagattaccgatcgtatcaaggaaaagatggatgaagaaaga
taa

DBGET integrated database retrieval system