KEGG   Lactococcus garvieae ATCC 49156: LCGT_1172Help
Entry
LCGT_1172         CDS       T01618                                 

Definition
(GenBank) hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
lgr00361  Chlorocyclohexane and chlorobenzene degradation
lgr00625  Chloroalkane and chloroalkene degradation
lgr01100  Metabolic pathways
lgr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lgr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LCGT_1172
   00361 Chlorocyclohexane and chlorobenzene degradation
    LCGT_1172
Enzymes [BR:lgr01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     LCGT_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6 PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: BAK58685
Position
complement(1166898..1167590)
Genome map
AA seq 230 aa AA seqDB search
MTVLLFDIDNTLLDFDKAEYMALGKIFEQYHIEDTKENRAIYSRENKALWRSHEAGEISR
EELLSTRFAHAFTALGVKEAYDASAVDAAYQLHLAQGHELMDHAMELLDRLAQEATEMYI
VSNGTSKVSRPRILESGIAGYFQEIFISEEIGKHKPSKEFFDYVFDHIDHAADKDFAIVG
DTLATDILGGKNAGIKTIWYNPKHLEAQKDLTPDCVIEDLLEIPSLPVLA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgactgtattactttttgacatagacaacacacttcttgattttgataaggcagagtac
atggctttaggcaaaatctttgagcaataccatattgaagatacaaaagaaaacagagcc
atctactcacgtgaaaacaaagccctttggcgaagtcatgaagcaggagaaatcagtcgt
gaagagcttctttctacacgctttgcacatgcttttacagctttgggagttaaagaagct
tatgatgcttcagctgttgatgcagcttaccaacttcacttggctcaaggtcatgaattg
atggatcatgccatggaacttttggatcgactggcgcaagaagcgacagagatgtacatt
gtgagtaacggtacatccaaagtttctcgtccacgaattttagaatctggcattgctgga
tatttccaagaaatttttatcagtgaagagattggaaaacacaaaccatcaaaagaattc
tttgattatgtgtttgaccacatcgatcacgctgcagataaagattttgcgattgttggt
gatactttagctacggatatcctcggcgggaaaaatgcaggtattaagacgatctggtat
aaccctaaacacttggaagctcaaaaagatttaacaccggattgtgtcatcgaagattta
ttagaaataccttctcttcctgtccttgcttga

DBGET integrated database retrieval system