KEGG   Lactococcus garvieae ATCC 49156: LCGT_1282Help
Entry
LCGT_1282         CDS       T01618                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
lgr00010  Glycolysis / Gluconeogenesis
lgr00051  Fructose and mannose metabolism
lgr00562  Inositol phosphate metabolism
lgr01100  Metabolic pathways
lgr01110  Biosynthesis of secondary metabolites
lgr01120  Microbial metabolism in diverse environments
lgr01130  Biosynthesis of antibiotics
lgr01200  Carbon metabolism
lgr01230  Biosynthesis of amino acids
Module
lgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lgr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGT_1282
   00051 Fructose and mannose metabolism
    LCGT_1282
   00562 Inositol phosphate metabolism
    LCGT_1282
Enzymes [BR:lgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LCGT_1282
Exosome [BR:lgr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LCGT_1282
  Exosomal proteins of bladder cancer cells
   LCGT_1282
  Exosomal proteins of melanoma cells
   LCGT_1282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAK58795
Position
complement(1280648..1281406)
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKLNKNLKEVKEFIANIDGKLPSEDKVEVAIAAPALYLVSMVQERGNNPL
KVAAENVYFENSGAFTGEIAPAMLAAEGIEYSVIGHSERREYFHETDEDINKKAKALIAA
GVTPILCCGETLETFEAGKTAEWVSAQIEAGLAGIDGKDVANMVIAYEPIWAIGTGKTAT
AEIADETCGVVRSTVEKLYGKEVSDAVRIQYGGSVKPETVAELMSKENIDGALVGGASLE
ADSFLGLLEIYK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaacctattatcgctggtaactggaaattgaataaaaacctcaaagaggtt
aaagaattcatcgctaacattgacggtaaattgccatcagaagacaaagtagaagttgca
atcgcagctcctgcactttaccttgtatcaatggtacaagaacgtggaaataacccactt
aaagttgcagctgaaaatgtttactttgaaaattcaggtgccttcactggtgaaatcgct
ccagctatgcttgcagcagaaggaatcgaatactcagtaatcggtcacagtgaacgtcgt
gagtacttccacgaaacagacgaagacatcaataaaaaagctaaagcgcttatcgcagct
ggtgtaacaccaatcctttgctgtggtgaaacacttgaaacttttgaagctggtaaaaca
gctgaatgggtttcagctcaaatcgaagctggtcttgctggtatcgacggtaaagatgtt
gcgaacatggttatcgcttacgaaccaatctgggctatcggtacaggtaaaactgcgaca
gctgaaatcgctgacgaaacttgtggtgttgttcgttcaacagttgaaaaactttacgga
aaagaagtttcagatgctgtacgtattcaatacggtggttctgtaaaacctgaaacagtt
gctgaacttatgtctaaagaaaatatcgacggtgccttggttggtggagcttcacttgaa
gctgattcattccttggcttgcttgaaatttacaaataa

DBGET integrated database retrieval system