KEGG   Lactococcus garvieae ATCC 49156: LCGT_1316Help
Entry
LCGT_1316         CDS       T01618                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
lgr00010  Glycolysis / Gluconeogenesis
lgr00030  Pentose phosphate pathway
lgr00051  Fructose and mannose metabolism
lgr00052  Galactose metabolism
lgr00680  Methane metabolism
lgr01100  Metabolic pathways
lgr01110  Biosynthesis of secondary metabolites
lgr01120  Microbial metabolism in diverse environments
lgr01130  Biosynthesis of antibiotics
lgr01200  Carbon metabolism
lgr01230  Biosynthesis of amino acids
lgr03018  RNA degradation
Module
lgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGT_1316
   00030 Pentose phosphate pathway
    LCGT_1316
   00051 Fructose and mannose metabolism
    LCGT_1316
   00052 Galactose metabolism
    LCGT_1316
  Energy metabolism
   00680 Methane metabolism
    LCGT_1316
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LCGT_1316
Enzymes [BR:lgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LCGT_1316
Protein phosphatases and associated proteins [BR:lgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LCGT_1316
Messenger RNA biogenesis [BR:lgr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LCGT_1316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAK58829
Position
complement(1321146..1322174)
Genome map
AA seq 342 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDK
VGRGGTFLYSARFPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDFTIGFDTAVSTVVDAIDKIRDTSSSHHRTFVVEVMGRNAGDIALWS
GIAAGADDIAIPEKEFKFESIVRNIKSGYAKGKNHHIIVVAEGVMSGEEFAMKLKAAGDD
SDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGIGGVAVGVRNEQLVESPILGT
AEENALFSLTDEGKIVVNNPHKAGLELYRLNADLNNLDIKFN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattgcagttttgacttctggtggtgatgcaccaggtatgaacgcagctatt
cgtgctgttgttcgtaaagcgatttctgaaggtatcgaagtttacggtatcaaccacgga
tatgcagggatggtagcgggcgatattttcccactaacatctgcaagtgttggtgataaa
gttggacgtggcggtacattcttgtattcagcacgtttcccagagtttgctcaacttgaa
gggcaacttgcgggtatcgagcaacttaaaaaacatggcatcgaaggtgttgttgttatt
ggtggtgatggttcttatcatggtgcaatgcgcttgactgagcatggcttcccagcagta
ggacttccaggtactattgataacgacatcgttggtacagattttacaatcggtttcgat
acagctgtttctacagttgtggatgccattgataaaattcgtgatacatcatcatctcac
caccgtactttcgttgttgaagttatgggacgtaacgctggagatatcgcgctttggtct
ggtatcgctgcaggtgctgatgatattgcaattcctgaaaaagaattcaaatttgaaagt
atcgtacgtaatatcaaatcaggatatgctaaaggtaaaaaccaccacatcatcgtagta
gctgaaggcgttatgtcgggtgaagaatttgccatgaagcttaaagctgctggtgatgat
tctgaccttcgtgtatctgttcttggtcacatccaacgtggtggatcacctacagcgcgc
gatcgcgttcttgcatcacgcatgggtgctcgtgcagtagaattgcttcgtgatggtatt
ggcggtgttgctgtcggtgtccgtaacgaacaacttgtcgaaagcccaattcttggtact
gcagaagaaaatgcccttttcagtctgacagatgaaggtaaaatcgttgtcaacaatcca
cacaaagctggattggaactctatcgtttaaacgctgatttaaacaatcttgacatcaaa
tttaattaa

DBGET integrated database retrieval system