KEGG   Lactococcus garvieae ATCC 49156: LCGT_1472Help
Entry
LCGT_1472         CDS       T01618                                 

Definition
(GenBank) fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
lgr00010  Glycolysis / Gluconeogenesis
lgr00030  Pentose phosphate pathway
lgr00051  Fructose and mannose metabolism
lgr00680  Methane metabolism
lgr01100  Metabolic pathways
lgr01110  Biosynthesis of secondary metabolites
lgr01120  Microbial metabolism in diverse environments
lgr01130  Biosynthesis of antibiotics
lgr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGT_1472
   00030 Pentose phosphate pathway
    LCGT_1472
   00051 Fructose and mannose metabolism
    LCGT_1472
  Energy metabolism
   00680 Methane metabolism
    LCGT_1472
Enzymes [BR:lgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LCGT_1472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos DUF87 Metallophos_2
Motif
Other DBs
NCBI-ProteinID: BAK58985
Position
complement(1453041..1454963)
Genome map
AA seq 640 aa AA seqDB search
MDEKYYKLLKEQFVSKEAVLTEIINLSAICELPKGTEHFVSDIHGEYDAFNHVLRNGSGS
IKEKLRECFPDLDPTEISELATLIYYPEEKLASKESQLSQEAFAYYCRENLISLLKVARF
AGKKYTRSKVRKAFPEKFRYILEELKHEVESSSEKRAYFDSIIEKLQHLGELPNLITALA
DSVRRLTVDHLHVVGDIYDRGPYPDKIIDRLISMPSVDVQWGNHDIIWMATLAGSPLAMM
NVIRISSRYGNLDILEDSYGINLRPLIEYAERYYEPSPAFAPRLTEGEYLSQEECDLLNK
LQQATAILQFKLESQLIARRPDFHLEERDVLHFINYDEKRISLKGKQYDLQEFQAPTVDP
VQPEQLSAEEEILLKKLLKNFKASQKLKKHIDFLLEKGSMYLSYNGNLLIHGCLPLHENG
DFKCFRLEGEAYSGRELLDLFEDHVRKSLAYPDVQEDLSTDLLWYLWVGESSSLFGKEAM
TTFERYYISDKATHVEKKNPYYRLREEPETICRILKNFGMDEKGHIINGHTPVKEKKGEE
PIKAGGKLIVIDGGFSKPYQKETGIAGYTLLYNSYGMQLAAHEPFKTIKAAVEDGSDIVS
VKRLVDRVEERTCVKDTNIGQELLKTIDDLEYLFENYEKY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaagtactataagctgctgaaagaacagtttgtatccaaagaagcagtctta
actgaaatcataaatctcagcgcaatttgtgaacttcctaaaggtacagagcattttgtg
agtgacatacatggggaatacgacgcttttaatcatgtcttgcgtaacggctcaggttcg
attaaagaaaagctccgtgaatgctttcctgacttagaccctaccgagatttcagagctg
gcaactttgatttattatccagaagaaaagttggcttccaaagaaagtcagctttcgcaa
gaggcatttgcttattattgccgtgagaacttgatttccttattgaaagtcgcgcgtttt
gcagggaaaaaatatacacggtcgaaagtgcgtaaagcttttccagaaaaattccgctat
attcttgaggaattaaaacatgaagttgaatcaagttctgaaaaacgtgcttattttgac
tcgatcattgaaaaacttcaacatctaggtgagcttccaaacttgattactgcacttgcg
gatagtgtgagacgtttgactgttgatcatttacatgtggtaggtgacatttatgatcgg
ggcccttatcctgataaaattatcgatcgtctaataagtatgccttcagtggatgttcag
tggggcaatcatgatattatctggatggccacgttggcaggttcaccgcttgcgatgatg
aatgttattcgtattagctcccgctatggtaacttggatattcttgaagattcctatggg
attaatttacgtccgttgattgaatatgcggagcggtattatgagcccagcccagccttt
gctcctcgtttgacggaaggagaatatctgtcgcaggaggagtgtgacttgctgaataaa
ctccaacaagcgacagcaatcttgcagttcaagttagaaagtcaattaattgcacggcgc
ccggattttcatctggaagagcgggatgttttgcattttattaattatgatgaaaaacgt
atctcactcaaaggcaaacagtatgatttgcaagaatttcaagcaccgacggttgatcca
gttcaaccggagcagttaagtgctgaggaagaaattttactgaaaaaactgctgaaaaat
tttaaggcttcccaaaagcttaaaaaacatattgattttcttttagaaaaaggttcaatg
tatctttcctacaatggcaatttactgattcatggttgcttgccccttcatgaaaatggt
gactttaagtgtttcaggcttgaaggagaagcttattctggacgtgaactgctcgattta
ttcgaagaccatgtgagaaagagtttggcgtatcctgatgtccaagaagatttatctaca
gacttactctggtatctgtgggtgggagaatcttcttcactttttggtaaagaagcgatg
accacttttgagcgttattacatctcagacaaagcaacacatgtggaaaagaaaaatcct
tactatcgtctaagagaagagcctgagacaatttgccgcattttgaaaaattttggtatg
gatgaaaaaggtcatattatcaatggacatacaccggtcaaagaaaagaaaggtgaagaa
ccaatcaaagcaggggggaagctgattgtgattgatggcggtttttctaagccttaccaa
aaagaaactggaattgcaggatacactttactttataacagttatggcatgcagctggca
gctcatgagccttttaaaacgataaaagcagctgtcgaagacggcagtgatattgtgagt
gtcaagcgattggttgatcgagtagaagaaaggacctgtgttaaagataccaatatcggt
caggagcttttgaagacaattgatgatttagagtatctttttgaaaactatgaaaaatat
tga

DBGET integrated database retrieval system