KEGG   Lactococcus garvieae ATCC 49156: LCGT_1635Help
Entry
LCGT_1635         CDS       T01618                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
lgr00230  Purine metabolism
lgr01100  Metabolic pathways
Module
lgr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LCGT_1635
Enzymes [BR:lgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LCGT_1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Cupin_4 RsgA_GTPase Streptin-Immun
Motif
Other DBs
NCBI-ProteinID: BAK59148
Position
complement(1614612..1615241)
Genome map
AA seq 209 aa AA seqDB search
MPERGLLIVFSGPSGVGKGTVRAKIFENENNFDYSVSMTTRAQRPGEIDGKDYYFRTREE
FEEMIRKGEMLEYAEYVGNYYGTPLTYVNQTLDEGKDVFLEIEVQGALQVKEKVPDGVFV
FLTPPDLEELRGRLVGRGTDSAEVINNRMMKAKEEIRLMSEYDYAVVNDKVELAAERVIK
IIEAEHYRVDRVMERYAHMIEKLDEDGKN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaacgtggtttattaattgtcttttctggtccttcgggagtaggaaaaggtact
gtccgtgcgaaaatttttgaaaatgaaaataactttgattactctgtatcaatgacaaca
cgtgcacaacgccctggtgaaatagatggaaaagattattatttccgtacacgtgaagag
tttgaagaaatgatacgtaaaggtgaaatgttagagtatgctgaatatgtcggcaactac
tacggcacacctttaacttatgtcaatcaaactttggatgaaggtaaggatgtatttctt
gaaatcgaagtgcaaggggccttacaagttaaggagaaagtaccagatggcgtatttgtc
ttcttgacgcctccagatttggaggagctacgtggtcgacttgttggccgtggtactgat
agcgcagaagttatcaataaccggatgatgaaagctaaagaagaaattcgcttgatgagt
gaatacgactatgctgttgtcaacgataaggttgaacttgctgcagaacgtgtcatcaag
attattgaggcagaacattatcgtgtcgatcgtgtgatggaacgttatgcacatatgatt
gagaagttagacgaagacggtaagaattaa

DBGET integrated database retrieval system