KEGG   Lactococcus garvieae ATCC 49156: LCGT_1737Help
Entry
LCGT_1737         CDS       T01618                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
lgr00010  Glycolysis / Gluconeogenesis
lgr00052  Galactose metabolism
lgr00500  Starch and sucrose metabolism
lgr00520  Amino sugar and nucleotide sugar metabolism
lgr00521  Streptomycin biosynthesis
lgr01100  Metabolic pathways
lgr01110  Biosynthesis of secondary metabolites
lgr01120  Microbial metabolism in diverse environments
lgr01130  Biosynthesis of antibiotics
lgr01200  Carbon metabolism
Module
lgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lgr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGT_1737
   00052 Galactose metabolism
    LCGT_1737
   00500 Starch and sucrose metabolism
    LCGT_1737
   00520 Amino sugar and nucleotide sugar metabolism
    LCGT_1737
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LCGT_1737
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LCGT_1737
Enzymes [BR:lgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LCGT_1737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: BAK59250
Position
1714520..1715485
Genome map
AA seq 321 aa AA seqDB search
MANKIIGIDLGGTSIKFGILTLEGEVQDKWAIPTNILSDGKHIVPDIIESINHRLNLYNL
DKSDFIGIGMGTPGTVDIEAATVRGAFNLNWADVQEVGAPISEGVGLPFILDNDANVAAL
GERWVGAGENQPDVVFITLGTGVGGGIVADGNLIHGVVGAAGEIGHIVVEPHDGFACTCG
NHGCLETVTSATGVVRLARKFAEEYEGSSPIKASIDNGDEVTSKDIFIAAEAGDAFALSV
VDKFAYYLGFACANLGSTLNPAAIVIGGGVSAAGEFLRSKVETYFQKYSFSTVRDSTKIK
LAELGNDAGIIGAASLALKFK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaaaattattggtattgacctcggcggaacttctatcaagttcggtattttg
acacttgaaggtgaagttcaagacaaatgggctatcccgacaaatattctcagtgatggg
aaacatattgtccctgatatcattgaatctatcaatcaccgtttaaatctttacaaccta
gataaatctgactttattggtattggaatgggaacgcctggtacagtagatattgaagct
gctactgtccgcggtgcctttaatcttaactgggcagatgttcaagaagtcggtgcgcct
attagcgaaggtgtcggcctccccttcattcttgacaatgatgcaaatgttgcagcttta
ggtgagcgttgggtcggagctggtgaaaatcaacccgatgttgtctttatcactttagga
actggagttggcggtggtattgttgctgatggaaatctcattcacggtgttgttggcgct
gcgggtgaaattggacatatcgtggtagaaccacatgatggctttgcttgcacttgtgga
aaccatggatgcttagaaacagtcacttctgctactggcgttgtgcgccttgcaagaaaa
ttcgctgaagaatacgaaggaagcagcccaattaaagcgagcatcgacaatggtgacgaa
gtaacttcaaaagacatcttcattgccgcagaagcaggtgatgcttttgcactgagcgtt
gtggataagtttgcttattaccttggttttgcttgtgctaaccttggcagtaccctaaac
cctgccgctattgtcatcggtggtggcgtttctgctgctggagaatttctccgctctaaa
gttgaaacttatttccaaaaatattcgttctcaacagtacgtgactctacaaaaatcaaa
cttgctgagctcggtaatgatgctggtatcatcggtgccgcaagccttgctttaaaattc
aaataa

DBGET integrated database retrieval system