KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_0463Help
Entry
LEGAS_0463        CDS       T01267                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00561  Glycerolipid metabolism
lgs00640  Propanoate metabolism
lgs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LEGAS_0463 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    LEGAS_0463 (gldA)
Enzymes [BR:lgs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     LEGAS_0463 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase PocR
Motif
Other DBs
NCBI-ProteinID: CBL91111
Position
466444..467520
Genome map
AA seq 358 aa AA seqDB search
MKSFSSPSLYIQGQDILLNHCDQMKRLGKRAVILSNGVAIDIAANPLSDKLNEQHLFSEV
LTISDDFDDYALSCLCQKIRHSNAGIVIAVGGGKVIDTAKIIAAQVECRLVVIPTLASTD
APTSRLSAKYNRQGNFERYIFFDDSPALVMVDTSIIVNAPTRTLIAGIADALATFIEYRA
VQCGNGHNMFGDRQTITAGVLAEQASKTIFQNAELAIEANNAHVVDNYFEAVVEANILMS
GLGFESGGEAAAHSIANGLTTFISPAIMHGEKVAFGLLGQLILSKSSDITYKKYLDFQRL
LGLPVCLKDLGIMNDQNILRQIAREILRPHETIHQMNLSFTEEDIVNMLLQIDSYAKK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtttttccagtccatctttgtatatacaagggcaagatattttattaaatcat
tgcgatcaaatgaaacgcctcgggaaacgtgcggttattcttagtaacggtgttgctatt
gatattgcagcaaatccgctatctgataaacttaatgaacaacatctgtttagtgaagtt
ctcactattagtgatgattttgatgattatgcgttgtcatgtttgtgccaaaaaatacgt
cattcaaatgctggtattgtcattgcagttgggggcgggaaagtcattgatactgcaaaa
attattgctgcacaagttgaatgtcgacttgttgttatcccgactttagcatcgacagat
gcgcctacatcaaggttatcagctaaatataataggcaagggaattttgagagatatatt
ttttttgatgatagtccagctttggttatggttgatactagcatcattgttaacgcacca
acacgtactttaattgctggtatcgcagatgcgcttgccacatttatagagtatcgtgcc
gttcaatgtggtaacggtcataatatgtttggggataggcaaacaataactgcaggtgta
ttagcggaacaagcgagtaaaacaatatttcaaaatgctgagttagctattgaagcaaat
aacgcacacgttgtcgataattattttgaagctgttgttgaggctaatattttgatgagt
ggattaggttttgaaagtggtggggaagcagcagcacacagtattgctaatggattaacg
acatttatatctccagctattatgcatggtgaaaaggttgcctttggtctgttagggcaa
cttatactttcaaaatcatcagatattacctataaaaaatatttagattttcaacgttta
ttaggtcttccggtatgtttgaaagacttaggcataatgaatgatcagaacatcttgcgt
caaattgcacgagaaatattacgtccacatgagacgatacatcaaatgaatttatctttc
acagaggaagatattgtgaatatgttattacagatagatagttatgcgaaaaaatag

DBGET integrated database retrieval system