KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_1018Help
Entry
LEGAS_1018        CDS       T01267                                 

Gene name
bdhA
Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lgs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LEGAS_1018 (bdhA)
Enzymes [BR:lgs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LEGAS_1018 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LEGAS_1018 (bdhA)
    1.1.1.-  
     LEGAS_1018 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C Pyr_redox_2 TrkA_N 2-Hacid_dh_C UDPG_MGDP_dh_N FtsJ Pyr_redox Titin_Z PrmA Pyr_redox_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CBL91666
Position
complement(1037660..1038706)
Genome map
AA seq 348 aa AA seqDB search
MKAAVWHGVKDVRVEEVELKPTKSNEVVVRVAYAGICGSDLHEYLEGPVFIPVDQPDELT
GGQAPLTMGHEFSGVIEKIGADVTKYKVGDHVSINPTITKGHVPDDVDVYDGYSFIGLST
DGGFTSHVNVPEDSLYRLPEDFSMKLAATIEPTAVAVQAVKEGGLRFGEKVVIFGAGPIG
VLVAAAAKAAGATKIVAVDLSEVRLNKALEMGATDIINPSQVDDTVAAIKNIIPGGADVS
FEVAGVQPTFEQAIDATRPRGTMVIVSIFARPITFNPMQLMNAGVKLTTTIAYSKETFQQ
TVDLVSSGQIDVAPVITDTIELDNIVTDGFESLTHDKSQAKIIVDLSK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtatggcatggcgttaaagatgttcgcgttgaagaagtggaattgaaa
ccaaccaaatcaaatgaagtggttgttcgcgttgcttacgctggtatctgtggtagcgac
ttgcatgaatatcttgaaggtccagtgtttattccggttgatcaaccagatgaactaaca
ggtggtcaagcaccgttaacaatgggtcatgaattttcaggtgttattgaaaaaattggt
gctgatgttactaagtataaagttggcgaccatgtgtcaattaatccaacgattactaaa
ggacatgtacctgatgatgtagatgtgtatgatggctacagtttcattggtttgagtact
gatggtggattcacttcacacgtcaatgtacccgaagatagcttgtatcgtttaccagaa
gatttttcaatgaaattagcagccacaattgaacctacagcagttgctgttcaggctgtt
aaagaaggtggtctacgtttcggtgaaaaagtagttatatttggtgctggaccaatcggt
gtattagtagcggctgccgcaaaagcagctggtgcgactaaaattgttgctgttgatcta
tctgaagttcgcctgaataaagcgcttgaaatgggagcaactgatattattaacccaagc
caagtagatgatacagtagctgccattaaaaatattattcctgggggtgcagatgtctcg
tttgaagtagctggggtacaacctacattcgagcaagcaattgatgcaacacgaccacga
ggtacaatggttattgtatcaatatttgcgcgcccaattacatttaacccaatgcaactc
atgaatgctggcgttaaattaacaacaactattgcctattcaaaagaaactttccaacaa
actgttgatcttgtaagtagtggtcaaattgatgtggcaccggtaattactgatacgatt
gaattagataatattgtgaccgatggttttgagtcactaacacatgataaatctcaagct
aaaattatagttgacttaagtaaatag

DBGET integrated database retrieval system