KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_1020
Entry
LEGAS_1020        CDS       T01267                                 
Symbol
queT
Name
(GenBank) Substrate-specific component QueT (COG4708) of predicted queuosine-regulated ECF transporter
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
SSDB
Motif
Pfam: QueT
Other DBs
NCBI-ProteinID: CBL91668
Position
complement(1039703..1040266)
AA seq 187 aa
MQKNLVKTDKSIGSVQNITLIAVIAAVYATITFVIQPFAFGPVQLRASEGLNHLAAWHKR
YIIALGLGVFIANLVSPLGWIDWIFGTMGTVIMTSITYLATRRVKHAVTKIVISSVVVAT
IGMAILAAEFTLAFNIGASGAFPSGSNGGLFAQWLAYYLSVMPGEVVSLIAGGIVIYALS
KMVDLSK
NT seq 564 nt   +upstreamnt  +downstreamnt
atgcaaaaaaatttagttaaaacggataagtctattggctcggtacaaaacattacgctg
atcgcagttattgcggctgtttatgctaccattacgtttgtgattcaaccttttgctttt
gggcccgtgcaattacgcgcctctgaaggattaaatcatttagcagcatggcacaaacgc
tatattatagcattaggtttaggggtatttattgctaatctggtttccccacttggttgg
attgattggatatttggaactatgggcactgttattatgactagcattacttacttagcg
acacgccgtgttaagcatgctgttacaaaaattgtaattagttcagtagtggttgcgacc
ataggcatggcaattttagctgcagaattcacattagcttttaatattggtgctagtggt
gcttttccttctggttcgaatggtgggctctttgcgcagtggctggcatattatttaagt
gtgatgcctggtgaggtggtttcattaattgctggtggtattgttatctatgcactaagt
aagatggttgacttaagtaaataa

DBGET integrated database retrieval system