KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_1522Help
Entry
LEGAS_1522        CDS       T01267                                 

Gene name
metG
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00450  Selenocompound metabolism
lgs00970  Aminoacyl-tRNA biosynthesis
lgs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LEGAS_1522 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LEGAS_1522 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lgs01007]
    LEGAS_1522 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lgs03016]
    LEGAS_1522 (metG)
Enzymes [BR:lgs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LEGAS_1522 (metG)
Amino acid related enzymes [BR:lgs01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LEGAS_1522 (metG)
Transfer RNA biogenesis [BR:lgs03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LEGAS_1522 (metG)
 Prokaryotic type
   Other AARSs
    LEGAS_1522 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 rve
Motif
Other DBs
NCBI-ProteinID: CBL92170
Position
complement(1563345..1565456)
Genome map
AA seq 703 aa AA seqDB search
MSEPNNVLFNTANLTDSAVIYDKFSKSEQQFSVQKDKTFYITTPIYYPSGKLQLGNTYTT
VLADAAARYHRLLGEDVYFLTGTDEHGLKIQQKAKAEGIPEINYLDGMAKGIKDLWQLMD
ISYDDFIRTTEERHEKAVQKIFTTLLENGDIYKGEYEGWYSVSDEEYFTESQLAEVYRDA
DDKMIGGKAPSGHDVELVKEEAYFFKMSKYADWLLDYYKTHPEFIQPEARMNEMINNFIA
PGLEDLAVTRTAVDWGISVPGDEKHVIYVWIDALSNYITALGYDSENTDLFEKFWPANVQ
LVGKEIVRFHTIYWPIMLHALGIELPKSVIGHGWLVMKDGKMSKSKGNVIYPEVLEERYG
LDAVRYYLLRAMPFGNDGVFTPEDFVARVNFDLANDLGNLLNRTVAMINKYENGVIPELR
TGKTDFDEALVRTSEDAITDYHKNFQDMRTADALENIWTIIRRANKYIDETQPWVLAKDD
TQKAVLSNVMAHLAGALRVVAVLLQPVLTKAPKKIYEQLGFEYPENGVRIAGLTFGKLPT
GGTVVKKGEPIFPRQDVEEEVRFISSLVSKDTKGKGRAVKEEAKKTAVTDEPTRELITYD
DFAKVEILAAKIIAGEIVEKSEKLLKFTLDDGSGKSRQILSGIRKWYADPAVLVGKTVAI
VANMKPRKMAGELSEGMILSAEKNDIVTVTILPDSIVPGSGIE
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaccaaataatgtcctttttaatactgctaatctcactgattcagcggttatc
tacgataagttttcaaaatcagaacaacagttttctgttcagaaggataaaactttctat
attacaacacccatttattatccttcaggaaagttgcagcttggtaatacctatacaacg
gtgcttgctgatgcggctgcgcgctatcaccgtttgttaggggaagatgtttattttttg
actggaactgacgagcatggacttaaaattcaacaaaaagcaaaagctgagggcatacct
gaaatcaattacttggatggtatggcgaaaggcattaaagatctctggcaactgatggat
atttcatacgatgactttattcgtacaactgaagaacgtcatgaaaaggctgttcaaaaa
atattcacgacattacttgaaaatggtgatatttataagggagaatatgaaggttggtat
tctgtttcagatgaagagtattttactgaatcacagttggcagaagtttatcgcgatgca
gatgataaaatgattggcggtaaggcgccttctgggcatgatgtcgagttagttaaagaa
gaagcgtacttcttcaaaatgagtaaatatgcagactggctgcttgattattacaaaacc
catccagaatttattcaacctgaagcacgcatgaatgaaatgattaataactttattgcg
cctggattggaagatttggcagttacgcgtacagctgtagattggggaatctcagttcct
ggagacgaaaaacatgttatctatgtttggattgatgcattatctaattatattaccgcg
ttaggttatgattccgaaaatacagatttgtttgaaaagttttggccagccaatgtccaa
ttagttggtaaggaaattgtacgctttcacacaatttattggcctatcatgttacatgcg
ctgggcattgaattaccaaaatcagttattggccatggttggctagtgatgaaagatggc
aaaatgtcaaagtctaagggcaatgttatttatcctgaagtacttgaggaacgttatggg
ttagacgccgtaagatactacttattaagagccatgccatttggcaatgatggggtattt
acacccgaagactttgtagcacgagttaattttgatttagctaacgatctgggtaattta
ctgaaccgtacagtggccatgattaataaatatgaaaacggtgtgatccctgaattgcgg
actggcaagactgattttgatgaagctttagttcgcacctctgaggacgctattactgat
tatcataaaaattttcaagatatgcgaaccgcagatgcattggaaaatatatggacaatt
attcgacgcgccaataaatatatcgatgaaacgcaaccatgggttttggccaaagatgac
acgcaaaaagcagtgttatcaaatgtcatggcacatttggctggtgcattacgtgtggtc
gctgtcctattgcaacctgttttgactaaagcacctaagaaaatttacgaacagcttggt
tttgagtatccagaaaatggtgtgcgtattgctgggctaacatttggtaagttgccaact
ggtgggacagtcgttaagaaaggtgaacctatttttccacgccaagacgttgaagaagaa
gtgcgttttatttcgagtctcgtgtcaaaagatacaaagggtaaaggtcgtgcagttaaa
gaagaagctaagaaaactgctgttacagatgaaccaacacgtgaactcattacgtatgat
gattttgctaaagttgagattttagctgctaaaatcatagcaggtgaaattgttgaaaaa
tcagaaaagttgcttaagttcactcttgatgatggttcaggtaagtcacgacaaattttg
tcaggtattcgtaaatggtatgctgatcctgctgtcttagttggcaagacggtagctatt
gtcgcaaacatgaaaccacgtaaaatggctggtgaactatcagagggcatgattttatca
gctgaaaaaaatgatattgtaacagtgactattttaccggattcaattgtgcctgggtca
ggtattgaataa

DBGET integrated database retrieval system