KEGG   Legionella geestiana: E4T54_06485Help
Entry
E4T54_06485       CDS       T06170                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lgt  Legionella geestiana
Pathway
lgt00450  Selenocompound metabolism
lgt00970  Aminoacyl-tRNA biosynthesis
lgt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    E4T54_06485
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    E4T54_06485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lgt01007]
    E4T54_06485
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lgt03016]
    E4T54_06485
Enzymes [BR:lgt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     E4T54_06485
Amino acid related enzymes [BR:lgt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   E4T54_06485
Transfer RNA biogenesis [BR:lgt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    E4T54_06485
 Prokaryotic type
   Other AARSs
    E4T54_06485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: QBS12421
UniProt: A0A0W0TP10
Position
1473018..1474667
Genome map
AA seq 549 aa AA seqDB search
MTNRRRMLVTSALPYANGHLHLGHLVEHIQTDIWVRTHKMLGHTCISVCADDAHGTPIML
KAAELGMTPQALTEDIRKSHEADFAAFRVDYDTYHTTHSPENEALAASIFEALNARGDIL
QKTIRQAFDPVENMFLPDRYVRGTCPRCKADDQYGDSCEVCGATYQPTDLINPRSVLSGA
TPVEKESLHYFFDLPRHEALLQAWTRGGHLQEEVANKLDEWFESGLKPWDISRDAPYFGF
RIPGTTDKYFYVWLDAPIGYMASFKKYCETTGTSFEEYWGADSTAELYHFIGKDIVYFHA
LFWPAMLAGSNHRLPTSVFAHGFLTVNGQKMSKSRGTFIEARTYLRHLNPEYLRYYFAAK
LNGRVEDIDLNLEDFSNRVNADLVGKVVNIASRSAGFIHKYFDGELADTLADPALFATLL
EARAAIIETYVARDSAKAVRLIMNEAERINQYIDTHKPWALAKDSNRLPDVQAVATMALN
GFRFLIGCLKPVLPSMAEASETFLQCAPLTFDNLESPLLKQRIAPFVPLMQRVEKDKTEA
LLKDSGAGA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccgccgccgcatgctcgtgacgagcgcccttccctatgccaacgggcatttg
caccttggccatcttgtggaacatatccagactgatatctgggtgcgcacgcacaaaatg
ctcgggcatacctgcatcagtgtctgtgccgatgacgcgcacggtacccccatcatgctg
aaggcggcggagcttggcatgaccccgcaggcgctgacagaagacattcgtaaaagccat
gaagccgattttgcggcttttcgtgtcgactatgacacctatcatacgacccattcaccg
gagaatgaggcgcttgccgcttccatttttgaagcgctgaatgcccgtggcgatattttg
caaaaaaccattcgccaggcgtttgatcctgtcgagaacatgtttctgccggaccgctat
gtacgcggcacctgcccgcggtgcaaggctgatgaccagtatggcgacagctgtgaagtc
tgtggcgctacctatcagccgacagaccttatcaacccgcgctctgtgctctcaggcgcg
actccggtagaaaaagaatctctgcactatttcttcgacctgccgcgtcatgaggcactg
cttcaggcctggacgcgtggcgggcacctgcaggaagaagtcgccaataagcttgatgaa
tggtttgaaagcggcttaaaaccctgggacatttcgcgggacgcgccatattttggtttt
cgcattccaggtaccacagataaatatttttacgtctggctcgatgcgccgattgggtac
atggcaagctttaaaaaatactgcgaaaccacaggcacttcgtttgaagagtactggggg
gctgacagtacggcggagctttatcatttcattggcaaagacatcgtatattttcatgcg
cttttctggccggcgatgctggccggcagcaatcatcgtctgccaacgtccgtgtttgcg
catggctttctgaccgttaacggccagaaaatgtcgaagtcccggggcacgtttatcgaa
gcgcgcacgtacctccgtcatttaaatcccgagtacctgcgctattacttcgcggcgaag
ctgaacgggcgggtagaggacattgacctcaaccttgaagacttcagtaaccgcgtaaat
gccgatttagtgggcaaggtcgtgaacatcgcgagccgttcagcgggctttatccataaa
tactttgacggcgagcttgccgacacactggcagaccccgcactttttgcaactctgctc
gaagcgcgtgcggccattatcgagacctatgtcgcgcgtgatagtgcgaaggccgtgcgc
cttatcatgaatgaggccgagcgcattaaccagtatatcgatacccataaaccctgggcg
cttgccaaagatagtaatcgcctgccagacgttcaggcggttgccaccatggcgctcaac
gggtttcgttttctcattggctgcctgaagcctgtgctgccatcaatggcagaagccagt
gaaacctttttgcagtgcgcgccgcttacgtttgacaatctggaatctcctctcctgaag
cagcgtatcgcgccgtttgtgccgctcatgcagcgggttgaaaaagacaagactgaggcc
ttactgaaagacagcggggcgggcgcatga

DBGET integrated database retrieval system