KEGG   Lysobacter gummosus: LG3211_0131Help
Entry
LG3211_0131       CDS       T04163                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
lgu  Lysobacter gummosus
Pathway
lgu00030  Pentose phosphate pathway
lgu00480  Glutathione metabolism
lgu01100  Metabolic pathways
lgu01110  Biosynthesis of secondary metabolites
lgu01120  Microbial metabolism in diverse environments
lgu01130  Biosynthesis of antibiotics
lgu01200  Carbon metabolism
Module
lgu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lgu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
lgu_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:lgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LG3211_0131 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LG3211_0131 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgu04147]
    LG3211_0131 (zwf)
Enzymes [BR:lgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     LG3211_0131 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     LG3211_0131 (zwf)
Exosome [BR:lgu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LG3211_0131 (zwf)
  Exosomal proteins of colorectal cancer cells
   LG3211_0131 (zwf)
  Exosomal proteins of bladder cancer cells
   LG3211_0131 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ALN89121
UniProt: A0A0S2G052
Position
141504..143021
Genome map
AA seq 505 aa AA seqDB search
MSVYSVPTPSQAPHLAPLAPFDLVIFGGTGDLALRKLLPALFHRYADGQIVAGTRIVAIA
RDTQSDEDYRGRVRDALAKFANLDARESQSVEGFLSLLLYRRLDLSSDSGWPEFSAEFAG
DERVRVFYLAVGPDLFGVVADRLQSHGLVSPKTRVVVEKPLGKDGVSADAINDALARVFA
ETQIFRIDHYLGKETVQNLTALRFGNALFEPLWKAEHIDHVQITVAETVGVESRAPYYDK
SGALRDMVQNHLLQLLCLVAMEPPSSLAADAIRDEKLKVLRALRPIVNGNAAQSTVRGQY
KAGAVDGTAVPGYAQELGAQSLTETFVAIKAEVKNWRWAGVPFYLRTGKRLGERVSEIVV
TFRQVPHSIFEDLTDQDPSSRLQPNKLVLRLQPDEGVKLWLMNKVPGPGGLRLRHVPLDM
SFAAAFGGRQADAYERLLMDVVRGNPMLFMRRDEVDAAWKWIDPIRAAWAAGAEAPRPYT
AGSWGPSAAVALIERDGRTWHEDAG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtctactccgtgccgactccctcgcaagccccgcatctggcgccgctggccccg
ttcgatctggtgattttcggcggcaccggcgacctggccctgcgcaagctgctgccggcg
ctgttccatcggtatgccgacggccagatcgtcgccggcacccgcatcgtggcgatcgcc
cgcgacacccagagcgacgaggactaccgcggccgggtgcgcgacgcgctggccaagttc
gccaatctggacgcgcgcgagtcgcagtcggtggaaggcttcctgtcgctgctgctgtat
cgccgcctggatctgagttccgacagcggctggccggagttctccgccgaattcgccggc
gacgaacgcgtgcgggtgttctacctcgcggtcggcccggacctgttcggcgtggtcgcc
gatcgcctgcagtcgcatggcctggtcagtcccaagacccgcgtggtggtggaaaaaccg
ctgggcaaggacggcgtcagcgccgatgcgatcaacgacgcgctggcgcgcgtgttcgcc
gaaacgcaaatcttccgcatcgaccattacctcggcaaggagacggtgcagaacctcacc
gcgctgcgcttcggcaatgccttgttcgagccgctgtggaaggccgagcatatcgaccac
gtgcagatcaccgtggccgaaacggtgggcgtggaatcgcgtgcgccgtactacgacaaa
tccggcgcgctgcgcgacatggtccagaaccatctgctgcagctgctgtgcctggtggcg
atggagccgccgtcctcgctggccgccgacgcgatccgcgacgaaaaactgaaagtgctg
cgcgcgctgcgcccgatcgtaaacggcaacgcggcgcagtccaccgtgcgcggccagtac
aaggccggcgcggtcgatggcaccgcggtgccgggctacgcgcaggaactgggcgcgcag
tcgctgacggaaaccttcgtcgcgatcaaggccgaagtgaagaactggcgctgggccggc
gtgccgttctacctgcgcaccggcaagcgcctgggcgagcgggtgtcggagatcgtggtg
accttccgccaggtgccgcattcgatcttcgaggatctgaccgatcaggatccgtccagc
cgcctgcaaccgaacaagctggtgctgcgcctgcagcccgacgagggcgtgaagctgtgg
ctcatgaacaaggtgcccggccccggcggcctgcgcctgcgccacgtgccgctggacatg
agtttcgccgcggccttcggcggccgtcaggccgacgcctacgagcgtttgctgatggac
gtggtgcgcggcaatccgatgttgttcatgcgccgcgacgaagtcgacgcggcctggaag
tggatcgacccgatccgcgccgcctgggccgcgggcgccgaagcgccgcgcccgtacacg
gccggcagttggggtccgagcgccgcggtggcgctgatcgaacgcgatgggagaacgtgg
catgaagatgcaggctga

DBGET integrated database retrieval system