KEGG   Lysobacter gummosus: LG3211_0328Help
Entry
LG3211_0328       CDS       T04163                                 

Definition
(GenBank) putative ACETYL-COA ACYLTRANSFERASE FADA2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lgu  Lysobacter gummosus
Pathway
lgu00071  Fatty acid degradation
lgu00072  Synthesis and degradation of ketone bodies
lgu00280  Valine, leucine and isoleucine degradation
lgu00310  Lysine degradation
lgu00362  Benzoate degradation
lgu00380  Tryptophan metabolism
lgu00620  Pyruvate metabolism
lgu00630  Glyoxylate and dicarboxylate metabolism
lgu00640  Propanoate metabolism
lgu00650  Butanoate metabolism
lgu00900  Terpenoid backbone biosynthesis
lgu01100  Metabolic pathways
lgu01110  Biosynthesis of secondary metabolites
lgu01120  Microbial metabolism in diverse environments
lgu01130  Biosynthesis of antibiotics
lgu01200  Carbon metabolism
lgu01212  Fatty acid metabolism
lgu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LG3211_0328
   00630 Glyoxylate and dicarboxylate metabolism
    LG3211_0328
   00640 Propanoate metabolism
    LG3211_0328
   00650 Butanoate metabolism
    LG3211_0328
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LG3211_0328
   00072 Synthesis and degradation of ketone bodies
    LG3211_0328
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LG3211_0328
   00310 Lysine degradation
    LG3211_0328
   00380 Tryptophan metabolism
    LG3211_0328
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LG3211_0328
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LG3211_0328
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LG3211_0328
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgu04147]
    LG3211_0328
Enzymes [BR:lgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LG3211_0328
Exosome [BR:lgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LG3211_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ALN89318
UniProt: A0A0S2G0U8
Position
369335..370612
Genome map
AA seq 425 aa AA seqDB search
MRQNRPVAVLGGVRIPFCRQNTAYADVGNLGMSVRTLGALVEKFGLHGQQLGEVAMGAVI
KHSSDWNLGREAALSSGLSPLTPGITLQRACGTSLDSIITIANKIAVGQIEAGIGGGSDT
TSDVPIVYGRSLRRRLLQAARARTTKDKIAAFKGFHLRELKPEFPGVAEPRTGKSMGDHC
EDMAKQWNISRDSQDEWALSSHQKLGAAYERGFFDDLVVSFRGVARDNILRTDSSLEKLA
TLKPAFDKTSGRGTLTAANSTPLTDGAAACLLASEEWAQAHNHEVLCYLRDAQVAAVDFV
HGEGLLMAPTVAVPEMLKRNGLTLQDFDIYEIHEAFAAQVLCTLRAWESEEYCKTRLGLD
APLGRIDPAKINPNGSSLAAGHPFAATGARIVATAAKELKQRGGGRCLISICTAGGMGVV
AILER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaaaaccgtcccgtcgccgtgctcggtggcgtgcgtattcccttctgccggcag
aacaccgcttatgcggacgtcggcaatctgggcatgtcggtgcgcacgctgggggcgctg
gtcgagaagttcggcctgcacggccagcagctcggcgaagtggcgatgggcgcggtaatc
aagcacagcagcgactggaacctgggccgcgaagccgcgttgtcctcgggcctgtcgccg
ctgacgccgggcatcaccctgcagcgcgcctgcggcacgtcgctggattcgatcatcacc
atcgcgaacaagatcgcggtcggccagatcgaggccggcatcggcggcggttcggacacc
acctccgacgtgccgatcgtctacggacgcagcttgcgccggcgcctgctgcaggccgcg
cgcgcgcgcacgaccaaggacaagatcgccgcgttcaagggcttccacctgcgcgagctc
aagcccgagtttcccggcgtggccgagccgcgcaccggcaagagcatgggcgatcactgc
gaggacatggccaagcagtggaacatctcccgcgattcgcaggacgaatgggcgctgtct
tcgcaccagaaactcggcgcggcgtacgagcgcgggttcttcgacgatctggtggtgagc
ttccgcggcgtcgcgcgcgacaacatcctgcgcaccgacagcagcctggaaaaactggcg
acgctgaagccggcgttcgacaagacctccggccgcggcaccctgaccgcggccaactcc
acgccgttgaccgacggcgccgcggcctgtctgctggcgtcggaagaatgggcgcaggcg
cataaccacgaagtgctgtgctacctgcgcgacgcgcaggtggcggcggtcgatttcgtc
cacggcgagggcctgctgatggcgccgaccgtggcggtgccggagatgctcaagcgcaac
ggcctgaccttgcaggatttcgacatctacgaaatccacgaagccttcgccgcgcaagtg
ctgtgcacgctgcgcgcttgggagagcgaggaatactgcaagacccgcctgggcctggac
gcgccgctggggcgcatcgatccggccaagatcaatccgaacggttcctcgctggcagcg
ggccatcccttcgccgcgacgggagcgcgcatcgtcgccaccgcggcgaaggaactgaaa
cagcgcggcggcggccgctgcctgatttcgatctgcaccgccggcggcatgggcgtggtg
gcgattctggagcgttga

DBGET integrated database retrieval system