KEGG   Lysobacter gummosus: LG3211_2722Help
Entry
LG3211_2722       CDS       T04163                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lgu  Lysobacter gummosus
Pathway
lgu00020  Citrate cycle (TCA cycle)
lgu00310  Lysine degradation
lgu00380  Tryptophan metabolism
lgu01100  Metabolic pathways
lgu01110  Biosynthesis of secondary metabolites
lgu01120  Microbial metabolism in diverse environments
lgu01130  Biosynthesis of antibiotics
lgu01200  Carbon metabolism
Module
lgu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lgu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LG3211_2722 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    LG3211_2722 (sucB)
   00380 Tryptophan metabolism
    LG3211_2722 (sucB)
Enzymes [BR:lgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LG3211_2722 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: ALN91689
UniProt: A0A0S2G797
Position
3048144..3049358
Genome map
AA seq 404 aa AA seqDB search
MSTEIKVPVLPESVSDATIATWHKKPGDAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FEEGSTVTSQQLIAIVEAGAAATASAPAAAAAPAAAKTEALPAAGAQPITAKADAPKAPA
GNDQLPPGARFTANKEGIDASQVEGTGRKGAVTKEDIVNYAKSGGVGNAAGARPEERVPM
TRIRARIAERLMQSKNSIAMLTSFNEVNLGKVMAMRKELGESFEKANGVKLGFMSFFAKA
AANALQRHPVVNASVDGNDIVYHGYADISIAVSTDKGLVTPVLRNVERMGFADVEKAIGD
YAKKARDGKLALEDLQGGTFTITNGGTFGSLMSTPIVNPPQSAILGMHAIKERAIVENGA
VVAAPMMYIALSYDHRIIDGKDAVLFLVDIKNQLENPHRMLLGM
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgagatcaaagtccccgtccttcccgagtcggtctccgacgccacgatcgcc
acgtggcacaagaagccgggcgatgcggtcaagcgcgacgagaacctggtcgatctggaa
accgacaaggtcgtgctggaagtgccctcgcccgtcgacggcgtgctcaaggaaatcaag
ttcgaagaaggctcgaccgtgaccagccagcagctgatcgcgatcgtcgaggccggcgcc
gccgccaccgcgagcgccccggccgctgccgccgctccggccgccgccaagaccgaagcc
ctgcccgccgccggcgcgcagccgatcaccgccaaggccgacgcgccgaaggcgccggcc
ggcaacgaccaattgcccccgggcgcgcgcttcaccgcgaacaaggaaggcatcgacgca
tcccaggtcgaaggcaccggccgcaagggcgcggtgaccaaggaagacatcgtcaattac
gccaagagcggcggcgtcggcaacgccgccggcgcgcgtccggaagagcgcgtgccgatg
acccgcatccgcgcccgcatcgccgagcgcctgatgcagtcgaagaactcgatcgcgatg
ctgacctcgttcaacgaagtcaacctcggcaaggtcatggccatgcgcaaggagctgggc
gagtccttcgagaaggccaacggcgtcaagctcggcttcatgagcttcttcgccaaggcc
gcggccaacgcgctgcagcgccatccggtggtcaacgcttccgtcgacggcaacgacatc
gtctatcacggctacgccgacatctcgatcgcggtgtccaccgacaagggcctggtcacg
ccggtgctgcgcaatgtcgagcgcatgggcttcgccgacgtcgagaaggccatcggcgat
tacgccaagaaggcccgcgacggcaagctggcgctggaagacctgcagggcggcaccttc
accatcaccaacggcggcaccttcggctcgctgatgtcgaccccgatcgtcaacccgccg
cagtcggccatcctcggcatgcacgcgatcaaggaacgcgccatcgtcgagaacggcgcc
gtcgtcgccgcgccgatgatgtacatcgcgctgagctacgaccaccgcatcatcgacggc
aaggacgcggtgctgttcctggtggacatcaagaaccaactggaaaatccgcatcgcatg
ttgctgggcatgtga

DBGET integrated database retrieval system