KEGG   Lysobacter gummosus: LG3211_4197Help
Entry
LG3211_4197       CDS       T04163                                 

Gene name
maiA
Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
lgu  Lysobacter gummosus
Pathway
lgu00350  Tyrosine metabolism
lgu00643  Styrene degradation
lgu01100  Metabolic pathways
lgu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lgu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    LG3211_4197 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    LG3211_4197 (maiA)
Enzymes [BR:lgu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     LG3211_4197 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: ALN93133
UniProt: A0A0S2GBS4
Position
complement(4700819..4701481)
Genome map
AA seq 220 aa AA seqDB search
MSDQLRLYSYWRSSASYRVRIGLNLKGLDYEIVPVHLVRNGGEQHAPAYRALNPQGLVPV
LQHGARTLTQSIAILEYLDETWPRPNLLPVTARDRHRVRAIAQTIACEIHPLNNLRVLQY
LDGTWNVPQPERDGWVKHWIIEGFTAVETMLAEDAATGTYCEGDTPGLADCCLIPQLYNA
RRFGVPLEAFPTILRIEQACLALPEFDKALPENQPDRPPG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatcaactgcggctgtattcgtactggcgttccagcgcgtcctatcgcgtgcgc
atcgggctcaacctcaagggcctggattacgagatcgtcccggtccatctggtccgcaac
ggcggcgaacaacacgctccggcctatcgcgcgctcaatccgcagggattggtgccggtg
ctgcagcacggcgcgcgcacgctgacgcaatccatcgcgatcctggaatacctggacgaa
acctggccgcggccgaacctgctgccggtgaccgcgcgcgaccgccatcgcgtgcgcgcg
atcgcccagaccatcgcctgcgaaatccacccgctcaacaatctgcgcgtgctgcagtac
ctggacggcacctggaacgttccgcagcccgagcgcgacggctgggtcaagcactggatc
atcgagggcttcaccgcggtggagacgatgctggccgaggacgccgccaccggcacctat
tgcgaaggcgacaccccgggcctggccgactgctgcctgatcccgcagttgtacaacgcg
cgccgcttcggcgtgccgctggaagcgttcccgaccatcctgcgcatcgaacaggcttgc
cttgccttgccggagttcgacaaggcgctgcctgagaatcagcccgatcgcccgccgggg
tag

DBGET integrated database retrieval system