KEGG   Lysobacter gummosus: LG3211_4357Help
Entry
LG3211_4357       CDS       T04163                                 

Gene name
alpP
Definition
(GenBank) alkaline phosphatase, placental type
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
lgu  Lysobacter gummosus
Pathway
lgu00730  Thiamine metabolism
lgu00790  Folate biosynthesis
lgu01100  Metabolic pathways
lgu02020  Two-component system
Module
lgu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lgu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LG3211_4357 (alpP)
   00790 Folate biosynthesis
    LG3211_4357 (alpP)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LG3211_4357 (alpP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgu04147]
    LG3211_4357 (alpP)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lgu00537]
    LG3211_4357 (alpP)
Enzymes [BR:lgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LG3211_4357 (alpP)
Exosome [BR:lgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LG3211_4357 (alpP)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lgu00537]
 Enzymes
  LG3211_4357 (alpP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Sulfatase Metalloenzyme Phosphodiest
Motif
Other DBs
NCBI-ProteinID: ALN93291
UniProt: A0A0S2GBU4
Position
4864777..4866426
Genome map
AA seq 549 aa AA seqDB search
MRQTPNSVAATVLGGAIFTALIALPVLAAPKQAAPKSPARQESAQRWFEEGAQTARDGAN
LRPSPFKAKNVILFVGDGMGISTISAARIREGQLKGGSGEEHSLSFERLPYVSLSKTYSV
DGQTPDSAPTMTAMVTGIKTNQGVLSVTQKAKYGDCASARGQGVVTMLELSEALGLATGI
VSTARITHATPAATYSHTPNRDWESDAELPAEAKANGCKDIARQLVEFPYGDGLEVALGG
GRGYFLPNTVSDPEDAGAAGRRKDGRNLPQEWAARAASPYVWNKAQFDAVDPRRTRHLLG
LFERSHMEYEQDRPNDSGKEPSLADMTSKAIDVLEANSRKGYFLMVEGGRVDHAHHAGNA
SRALTDTIALSDAVRKALEKTSERDTLIIVTADHSHTFTVAGYPDRGNDILGKVVTNGRL
ALDKNGKPYTTLGYVNGPGYRGPNARPDLTAIDTTHQDYLQEATVPLSDETHAAEDVAIY
ARGPGAHSFQGVVEQNTIFHVMAQSQRNTSIFLCTLLGQCGNGRGRSAIAAPLMEEDLRA
GMARQSAKL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagactccgaattccgtcgccgccaccgttctcggcggcgccatcttcaccgct
ctcatcgccctgcccgtgctggccgcgcccaaacaggccgcgcccaagtcgccggcccgc
caggaaagcgcgcagcgctggttcgaggaaggcgcgcagaccgcgcgcgacggcgccaac
ctgcgcccgagcccgttcaaggccaagaacgtgattctgttcgtcggcgacggcatgggc
atttccaccatctccgccgcgcgcatccgcgaaggccagctcaagggcggcagcggcgaa
gagcattcgctgtcgttcgagcgcctgccgtacgtgagcctgtccaagacctactcggtc
gatggccagacgccggattcggcgccgaccatgaccgcgatggtcaccggcatcaagacc
aaccagggcgtgctcagcgtcacgcagaaagccaagtacggcgactgcgcctccgcgcgc
ggccagggcgtggtcaccatgctggaactgtccgaggcgctgggccttgcgaccggcatc
gtcagcaccgcgcgcatcacccacgccacgccggcggccacgtattcgcatacgcccaac
cgcgattgggaaagcgacgccgagctgcccgccgaggccaaggccaacggctgcaaggac
atcgcccgccagttagtcgaattcccctacggcgacggcctggaagtcgcgctcggcggc
ggccgcggctacttcctgcccaacaccgtgagcgatccggaagacgccggcgccgccggc
cgccgcaaggacggccgcaacctgccgcaggaatgggccgcgcgcgcggcttcgccttac
gtgtggaacaaggcccagttcgacgccgtcgatccgcgccgcacccgccatctgctgggc
ctgttcgagcgctcgcacatggaatacgagcaagaccgcccgaacgacagcggcaaggaa
ccgagcctggccgacatgacctcgaaggccatcgacgtgctggaagccaacagccgcaaa
ggctacttcctgatggtcgaaggcggccgcgtcgatcacgcgcaccacgccggcaacgcc
agccgtgcgctcaccgacaccatcgcgctgtcggacgcggtgcgcaaggcgttggagaag
acctccgagcgcgacaccctgatcatcgtcaccgccgaccacagccacaccttcaccgtc
gccggctatcccgaccgcggcaacgacatcctcggcaaggtcgtcaccaacggccgactg
gcgctggacaagaacggcaagccctacaccacgctgggctacgtcaacggccccggctac
cgcggcccgaacgcgcgtccggacctgaccgcgatcgacaccacgcaccaggattacctg
caggaagcgaccgtgccgctgagcgatgaaacccacgccgcggaagacgtcgccatctac
gcccgcggccccggcgcgcattcgttccagggcgtggtcgagcagaacacgatcttccac
gtgatggcgcagtcgcagcgcaacaccagcatcttcctgtgcaccctgctgggccagtgc
ggcaacggccgcggccgctccgcgatcgccgccccgctgatggaagaagacctgcgcgcg
ggcatggcgcggcagtcggccaagctgtga

DBGET integrated database retrieval system