KEGG   Lactococcus garvieae Lg2: LCGL_1083Help
Entry
LCGL_1083         CDS       T01963                                 

Definition
(GenBank) D-alanine activating enzyme
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
lgv00473  D-Alanine metabolism
lgv01100  Metabolic pathways
lgv01503  Cationic antimicrobial peptide (CAMP) resistance
lgv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lgv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LCGL_1083
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LCGL_1083
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LCGL_1083
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:lgv01504]
    LCGL_1083
Enzymes [BR:lgv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     LCGL_1083
Antimicrobial resistance genes [BR:lgv01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    LCGL_1083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AntA
Motif
Other DBs
NCBI-ProteinID: BAK60543
UniProt: F9VDZ2
Position
complement(1101310..1102812)
Genome map
AA seq 500 aa AA seqDB search
MNIFQEILSGATKYPERLAIVEHDQDYTYHQLLDAASQVAKKISELPISQRPIIVFGKNG
FLSLAALLGVSLTGRAYIPVDAHTPFERTQLIMQAANPSLVIHTVELEENFSQLFTSRIS
YTEYQENTDFDFSQIDSRQAVAGDDINYIIYTSGTTGLPKGVAVIHNNLLSFTEWMNKDF
SIIENNHFLSQALYSFDLSIFSLYPSLTTGGTLISLSQEETTNFKKLFERLNSSTINTWV
STPSFIEICLLDPSFIEENHQELQQFIFCGEELPHKTASKLLDKFPYAKVWNTYGPTEAT
GAITSIQIDERILQDYKRLPIGTAKPGVEIQIIEDEIIIIGDSVAQGYFENAEKTAEVFY
ELEGKKGYHTGDSGYFDENSVLNYNGRIDFQVKFNGFRIELQDIEAHLYEIVEIEKALVV
PQENDAHKVTGLIAVLHCSLDFANKAEERAFNKKIKAQLSNTIMEYMMPTKFIYLDDFPL
TPNGKIDRKALTKQVLGGKN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttttcaagaaattttatccggagcaacaaaatacccggaacgtttagcgata
gtcgaacacgatcaagattatacttatcatcaattgcttgatgctgcatcacaggtagct
aaaaaaatatctgaattgcccatctcccaacggccaattattgtgtttggtaaaaatgga
tttttatcattagctgcactgctcggtgtttcacttacaggtagagcctatattcctgta
gacgcgcatacaccttttgagagaacgcagctgatcatgcaagccgcaaatccatcttta
gtcatacatacagtagaacttgaagaaaatttttcccagctttttacatcaagaatatct
tatacagaataccaagaaaatactgattttgatttttcacaaattgatagtcgtcaagct
gttgccggagatgatattaactacattatctatacttcgggcacaacggggcttccaaaa
ggtgtagcagtaatacacaataacttacttagcttcactgaatggatgaataaggatttt
tcgataattgaaaataatcactttctctctcaggcattatatagttttgatctatcaatt
ttcagcttgtatcctagcttgacaacgggtggaaccttgatttcacttagccaagaggag
acaacgaatttcaaaaaactttttgaacgattgaattcaagtacaatcaatacttgggtt
tctacaccatcgtttatcgaaatctgtttgcttgatccatcatttattgaggaaaatcat
caagagttacaacaattcattttttgtggcgaggaattaccgcacaaaacggcatccaag
ctgctcgacaagttcccctatgcaaaagtttggaatacttatggtccaaccgaagctacg
ggtgctattacaagtattcaaattgatgaaagaattcttcaagactataagcgcctgcct
attggcactgccaaaccaggagtggaaatccaaatcattgaggatgaaattattattatt
ggagattccgtcgctcaaggatattttgaaaatgcggagaagacagcagaagtcttctat
gagctagaaggaaagaagggttatcatacaggagattcaggttattttgatgaaaattca
gtcctgaactataatggtcgaatcgattttcaagtaaagtttaatggttttaggatcgag
ctgcaagatatcgaagctcatttatatgaaattgtggagattgaaaaagcattagtggtc
cctcaagaaaatgatgcccataaagtaacgggattgatagcggtccttcattgttctttg
gattttgcaaataaggctgaagaacgcgcatttaataaaaaaatcaaggcacaactttca
aatacgattatggaatatatgatgccgactaagttcatttatcttgatgattttccgctt
actcctaatggaaaaattgaccgtaaagctttaaccaagcaagtccttggaggtaagaac
tag

DBGET integrated database retrieval system