KEGG   Lactococcus garvieae Lg2: LCGL_1673Help
Entry
LCGL_1673         CDS       T01963                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
lgv00010  Glycolysis / Gluconeogenesis
lgv00030  Pentose phosphate pathway
lgv00051  Fructose and mannose metabolism
lgv00680  Methane metabolism
lgv01100  Metabolic pathways
lgv01110  Biosynthesis of secondary metabolites
lgv01120  Microbial metabolism in diverse environments
lgv01130  Biosynthesis of antibiotics
lgv01200  Carbon metabolism
lgv01230  Biosynthesis of amino acids
Module
lgv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lgv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGL_1673
   00030 Pentose phosphate pathway
    LCGL_1673
   00051 Fructose and mannose metabolism
    LCGL_1673
  09102 Energy metabolism
   00680 Methane metabolism
    LCGL_1673
Enzymes [BR:lgv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     LCGL_1673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase IMPDH BKACE
Motif
Other DBs
NCBI-ProteinID: BAK61133
UniProt: F9VFN2
Position
complement(1649116..1650012)
Genome map
AA seq 298 aa AA seqDB search
MAIVSAEKFVQAARDNGYAIGGFNTNNLEWTQAILRAAEAKQTPVLIQTSMGAAKYMGGY
KMCKLLIETLVESMGITVPVAIHLDHGHFDDALECIEVGYSSLMFDGSHLPIEENLKLAE
EVITKAHAKGISVECEVGSIGGEEDGIVGEGELAPIEDAVAMAKLGVDFLAAGIGNIHGP
YPENWKGLHIDHLTKLNEALVAAMGKNVPIVLHGGSGIPDDQIREAIANGVAKINVNTEC
QLAFAKATREFVVEFNANEAEYMKKKLFDPRKFLKPGFDAITASVEERIDVFGSANKA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgtttcagcagaaaaattcgtacaagccgctcgtgacaatggttacgctatc
ggtggtttcaacacaaacaaccttgaatggactcaagctatcttgcgcgcagcagaagct
aaacaaactccagtacttatccaaacttcaatgggtgctgctaaatacatgggtggttac
aaaatgtgtaaactcctcattgaaactcttgtagaatcaatgggaatcactgtaccagta
gctattcaccttgaccacggtcactttgatgatgctttggaatgtatcgaagttggttac
tcttcattgatgtttgacggttcacaccttccaatcgaagaaaaccttaaacttgctgaa
gaagttatcacaaaagctcacgctaaaggtatctcagttgagtgtgaagttggttctatc
ggtggtgaagaagacggtatcgtcggtgaaggcgaacttgctcctatcgaagatgcagta
gcaatggctaaacttggtgttgacttccttgcagctggtatcggtaacatccacggtcct
tacccagaaaactggaaaggtctccacatcgatcacttgactaaattgaacgaagcactt
gttgctgctatgggcaaaaatgttcctatcgtattgcacggtggttcaggtatccctgac
gatcaaatccgcgaagcaatcgctaacggtgtagctaaaatcaacgtaaacacagaatgc
caacttgcatttgcaaaagcaactcgtgaattcgtcgttgaatttaacgctaacgaagct
gaatacatgaagaaaaaactcttcgacccacgtaaattcttgaaacctggtttcgacgca
atcactgcatcagttgaagaacgtatcgacgttttcggttcagcaaacaaagcataa

DBGET integrated database retrieval system