KEGG   Lysinibacillus varians: T479_04760Help
Entry
T479_04760        CDS       T03062                                 

Definition
(GenBank) coenzyme A biosynthesis bifunctional protein CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
lgy  Lysinibacillus varians
Pathway
lgy00770  Pantothenate and CoA biosynthesis
lgy01100  Metabolic pathways
Module
lgy_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:lgy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    T479_04760
Enzymes [BR:lgy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     T479_04760
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     T479_04760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein DFP
Motif
Other DBs
NCBI-ProteinID: AHN20860
UniProt: X2GQC6
Position
1013619..1014626
Genome map
AA seq 335 aa AA seqDB search
MNKNILLCVSGGIAVYKAVALVSKLSQAGARVKVIMTASARQFVNPLSFQVMSKNDVYFD
TFDEKDSNVIAHIDLADWADLILVAPATANVIGKLANGIADDMVTTTLLATTVPVWIAPA
MNVHMYDHPAVKRNLAQLATDGYQFIEPSEGFLACGYVGKGRLEEPEKITALVQQYFFAP
KPLAGRTVLVTAGASYVPMDNQHVISTKANGKVGQALAREAQALGAHVILLGEEATNAYD
LITQVENVKKQNAQLLFIHAANIPTIESAPTLSIAGTEAVTFGQKVLGNPVLQVIADEWI
DYSQTATINGQIVNISDTTQFAKVLWQHILQGESQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaatattttactttgtgtttcaggtggtattgcggtttataaagctgtcgcg
ctagtgagtaaactatcgcaggcgggtgcccgtgtaaaggtcattatgacagcatcagcc
cggcagtttgtcaatccgctaagctttcaagtcatgtcaaaaaatgatgtctacttcgat
acatttgatgaaaaagattcgaatgtcattgcccatatagatttagctgactgggcagat
ttaatattagtcgctcctgcaactgccaatgtgattggcaaactagcaaacggtattgca
gacgatatggtaacaacgacattacttgctactactgtacctgtttggattgcacccgcg
atgaatgtccatatgtatgatcatccagcggtaaagcgtaatttggcacaactagcaaca
gatggttatcaatttatcgaaccgtcagaaggctttttagcatgtggctatgttgggaaa
ggtcgtttagaggagccagagaaaattacggcacttgtgcaacagtattttttcgctcca
aagccattagcaggacgaacggtgcttgtaacagcaggagcaagttatgtccctatggat
aatcagcatgtaattagtacaaaggccaatggtaaggttggacaagcgttagcgagagaa
gcgcaagcactaggggcacatgtcattcttttaggtgaagaagcaacaaatgcgtatgat
cttataacgcaagtagagaacgttaaaaagcaaaacgcacagctcttatttatccacgca
gccaacataccaacaattgaaagtgcccctactctatccattgcaggtacagaggcagtg
acatttggacaaaaagtgctagggaatccggtgttacaagtaatagccgatgaatggatt
gactatagtcaaacagcaacaataaacggacaaattgtcaatatttcagatacgacacaa
tttgcaaaagttttatggcagcatatattacaaggtgagtcgcaatga

DBGET integrated database retrieval system