KEGG   Lysinibacillus varians: T479_06080Help
Entry
T479_06080        CDS       T03062                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lgy  Lysinibacillus varians
Pathway
lgy00071  Fatty acid degradation
lgy00072  Synthesis and degradation of ketone bodies
lgy00280  Valine, leucine and isoleucine degradation
lgy00310  Lysine degradation
lgy00362  Benzoate degradation
lgy00380  Tryptophan metabolism
lgy00620  Pyruvate metabolism
lgy00630  Glyoxylate and dicarboxylate metabolism
lgy00640  Propanoate metabolism
lgy00650  Butanoate metabolism
lgy00900  Terpenoid backbone biosynthesis
lgy01100  Metabolic pathways
lgy01110  Biosynthesis of secondary metabolites
lgy01120  Microbial metabolism in diverse environments
lgy01130  Biosynthesis of antibiotics
lgy01200  Carbon metabolism
lgy01212  Fatty acid metabolism
lgy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    T479_06080
   00630 Glyoxylate and dicarboxylate metabolism
    T479_06080
   00640 Propanoate metabolism
    T479_06080
   00650 Butanoate metabolism
    T479_06080
  09103 Lipid metabolism
   00071 Fatty acid degradation
    T479_06080
   00072 Synthesis and degradation of ketone bodies
    T479_06080
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    T479_06080
   00310 Lysine degradation
    T479_06080
   00380 Tryptophan metabolism
    T479_06080
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    T479_06080
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    T479_06080
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    T479_06080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgy04147]
    T479_06080
Enzymes [BR:lgy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     T479_06080
Exosome [BR:lgy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   T479_06080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHN21090
UniProt: X2GR18
Position
1303963..1305147
Genome map
AA seq 394 aa AA seqDB search
MTNEVVIVSAVRTAIGSFQGTLKDVPATTLGSIVIKEALARAGVAGEQVDEVIMGNVLSA
GLGQNPARQASIAAGLPNTVPALTINKVCGSGLKAVHLATQAIIAGDADIIVAGGFENMS
QAPYVLKNAREGFRMGDQKVVDTMIHDGLWCAFNDYHMGITAENLCDAYEISREEQDAFA
ARSQQRAEAAIAAGKFNNEIVAVEIPQRKGESIIFDQDEFPRAGVTAESLAKLRPAFKKD
GSVTAANASGINDGAAAVVVMSKAKAIELGIQPMALISANASAGVDPSIMGTGPVTAVKK
ALAKADVSLVDIDLIEANEAFAAQSIAVDRELGFNHDKLNVNGGAIALGHPIGASGARIL
VTLLHEMEKRDAKTGLATLCIGGGQGVATVVQRP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgaggtagtgattgttagtgccgtgcgtacggcaatcggttcattccaagga
acattaaaagatgtaccagcaacaactcttggaagtatcgttattaaagaagcattagca
cgtgctggtgtagcaggtgaacaagtcgatgaagtcattatggggaatgtattatcggca
ggtcttggacaaaatccagctcgacaagcttcgattgctgcgggacttccaaacacagtg
ccagctttaacaattaataaagtatgtggctcaggtttaaaagcagtgcatttagcaaca
caagcaattattgctggcgatgcagatatcatcgtggcaggcggtttcgaaaatatgagc
caagcgccttatgtattaaaaaatgcacgtgaaggcttccgcatgggcgatcaaaaagtt
gtggatacgatgattcatgatggcttatggtgtgcatttaatgactatcatatggggatt
actgccgaaaatttatgtgatgcgtatgaaatttctcgtgaggagcaagatgcttttgct
gcgcgatcacagcaacgtgcagaagcggcgattgcagcagggaaatttaataatgaaatc
gtggctgtggaaatcccacaacgtaaaggcgagtcgattatttttgaccaagatgaattt
ccacgtgcaggggttacggcggaatcattagcaaagctgcgtccagcctttaaaaaggac
ggctctgtaactgcagcgaacgcttcaggtattaacgatggagcagcagcggtggttgtt
atgtcaaaagcgaaggctatcgagttaggtattcagccaatggcgcttatttcagccaat
gcgagcgcaggtgtagatccatcgattatgggaactgggccggtcacagcggtgaagaaa
gcattagcgaaggcggatgtttcgctagtagatatagatttaattgaagcaaatgaagca
tttgcagcacaatcgattgctgtcgatcgcgaactaggctttaatcatgataaactaaat
gtaaatgggggagcaattgcccttggtcatccaattggagcaagtggggcacgaatttta
gtgacactgttacatgagatggaaaaacgtgatgcaaaaacaggccttgctacattatgc
atcggtgggggacaaggcgtagcaacagttgttcaacgcccttaa

DBGET integrated database retrieval system