KEGG   Lysinibacillus varians: T479_08015Help
Entry
T479_08015        CDS       T03062                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
lgy  Lysinibacillus varians
Pathway
lgy00020  Citrate cycle (TCA cycle)
lgy00620  Pyruvate metabolism
lgy01100  Metabolic pathways
lgy01110  Biosynthesis of secondary metabolites
lgy01120  Microbial metabolism in diverse environments
lgy01130  Biosynthesis of antibiotics
lgy01200  Carbon metabolism
Module
lgy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lgy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    T479_08015
   00620 Pyruvate metabolism
    T479_08015
Enzymes [BR:lgy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     T479_08015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox Pyr_redox_2 PepSY_2
Motif
Other DBs
NCBI-ProteinID: AHN21399
UniProt: X2GVP5
Position
1690855..1692342
Genome map
AA seq 495 aa AA seqDB search
MSNRVTKSDVILIGAGIMSATLGTMLKELAPDWNITVFEKLSNAGEESSNEWNNAGTGHA
ALCELNYTSEKPDGTIDISKAINVNEQFQVSMQFWSYLVKNKLIQNPQDFIMPLPHMSMV
RGEKNVEYLRKRYETMSNNPLFKGMEFSDNPEKLKEWIPLIMEDRPANEAIAATKIDTGT
DVNFGALTRILFDHLKAKDVDINYNHSVESIKRTKDGLWELKVHDKDGCKMEYHTAKFVF
LGAGGGSLELLQKSGIPEGKHIGGFPISGLFMVCKNQEVVEQHHAKVYGKAAVGAPPMSV
PHLDTRFIDNKKSLLFGPFAGFSPKFLKTGSNMDLFASVKPHNITTLLAAGVKEMSLTKY
LIQQLLLSKDQRMEELREFIPTAKSEDWDIVVAGQRVQVIKDTEAGGKGTLQFGTEVVSA
ADGSIAALLGASPGASTAVHVMLQVIQKCFPQQAKEWEPKLKEMIPSYGISLLQNPELLE
EVHTSTAETLGLNKN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacagagtaactaaatcagacgtcatcttaattggtgccggaattatgagtgcg
actttggggacaatgctcaaagaattagcaccggactggaatattactgtgtttgaaaaa
ctttcaaacgccggtgaggaaagctctaatgaatggaataatgcaggaacagggcatgca
gcactatgcgagcttaactacacttctgaaaaaccagacggtactattgatattagcaaa
gcaattaatgttaatgaacagttccaggtttcgatgcagttttggtcatatcttgtaaag
aacaagctgatccaaaatccgcaagattttattatgccattaccacatatgagtatggta
agaggtgaaaaaaacgttgagtatttaagaaaacgttatgaaacaatgtcaaataatcct
cttttcaaagggatggaattctctgataatccagaaaaacttaaagaatggattccactt
attatggaagaccgcccagcaaatgaggccattgctgcaacaaaaattgacactggtaca
gacgttaacttcggtgctctaacacgtattttatttgaccacctaaaagcgaaagatgta
gatatcaactacaaccatagtgtcgaaagcattaaacgtacgaaagacggtttatgggaa
ttaaaagtacatgataaagatggctgtaaaatggaataccatacagcaaaattcgtcttc
cttggagctggcggaggaagtcttgaattattacaaaaatcaggcattcctgaaggaaaa
cacattggtggattcccaattagtggattgtttatggtatgtaaaaaccaagaagtggtt
gaacaacatcatgcaaaagtatatggtaaagctgcagttggtgcaccaccaatgtctgtt
ccacatttagacactcgctttatcgataacaaaaaatcattactatttggaccatttgct
ggtttctcaccaaaattcttaaaaacaggttcgaacatggacttattcgcttctgtaaaa
ccgcataatattacaacattattagcggcaggggttaaagaaatgtctttaacaaaatat
ttaatccaacaactgttattatcaaaagatcaacgtatggaagagttacgtgagtttatc
ccaactgctaaaagcgaggactgggatattgtcgtagcaggtcaacgtgtacaagttatc
aaagatactgaagctggcggtaaaggaacattacaatttggtaccgaagtagtaagtgct
gctgacggatcaatcgctgcattattaggtgcttcaccaggtgcatctactgccgttcac
gttatgttgcaagttattcaaaaatgtttccctcaacaagctaaagagtgggagccaaaa
ctaaaagaaatgattccatcttacggtatctcattattacaaaatccagagcttcttgaa
gaagttcatacttcaacagcagagactctaggcctaaacaaaaactaa

DBGET integrated database retrieval system