KEGG   Lysinibacillus varians: T479_10295Help
Entry
T479_10295        CDS       T03062                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lgy  Lysinibacillus varians
Pathway
lgy00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    T479_10295
Enzymes [BR:lgy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     T479_10295
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     T479_10295
    1.1.1.-  
     T479_10295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C Pyr_redox_3 UDPG_MGDP_dh_N Pyr_redox_2 AlaDh_PNT_C TrkA_N PALP ADH_N_assoc HI0933_like IlvN
Motif
Other DBs
NCBI-ProteinID: AHN21758
UniProt: X2GND7
Position
2124251..2125300
Genome map
AA seq 349 aa AA seqDB search
MKAAVWYGEKDIRIEDRELKALKDNEVTVRVAWAGICGSDLHEYQEGPVFIPTKEKDELT
GEIAPLIMGHEFAGTIEKVGANVTKFKVGDRVAINPTLTHGNKPEDMDAYDGFSFIGLHG
DGGFTTYANAPESNVYLLPETMTLEDGALVEPTAVAVQAVKEGNLRFGDTVAIFGAGPIG
LLTAIAAKAAGASKIIVLDLSETRLEKAKELGATHVINSGEVDGVEAIRAIVPDGVDVSF
EVAGVAPTFKQAIDATRARGTMVIVSIFARPIEWNPIHLTNTGVKITSSIAYTPTSFQQT
VDLMGSGQLKPQGIITGRIQLDDIVEKGFEALTNDKSQAKILVELSGEK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtttggtacggagaaaaagacattcgtattgaggacagagaattaaaa
gctcttaaagataatgaagttacagttcgtgtagcttgggctggtatttgtggtagtgat
ttacatgaatatcaagaaggacctgtctttattccaacaaaagaaaaagatgaattaact
ggtgaaatcgctccactgattatggggcatgaatttgcaggaactattgaaaaagttggt
gcaaacgttactaagtttaaagtgggcgatcgcgttgcaattaaccctacattaacgcac
ggtaacaaacctgaagatatggacgcttatgatggttttagcttcatcggtttacatggc
gatggtggcttcactacttatgcaaatgctcctgaaagtaatgtttatttactacctgaa
acaatgacacttgaagacggtgcacttgttgaaccgacagctgtagcagtacaagctgta
aaagagggtaatttacgtttcggtgatactgtggcgatttttggtgctggcccaatcggc
ttattaactgctattgcagctaaagcagctggtgcaagtaaaattatcgtattagattta
tctgaaacacgtcttgaaaaagcaaaagaacttggtgcaacgcacgtgattaactctggt
gaagtagatggtgtagaagcaattcgcgcaatcgttccagatggtgtggatgtatcattt
gaagttgcaggtgttgcgccaacatttaaacaagcaatcgatgcaacaagagctcgtggt
actatggttattgtatcaatctttgctcgtccaattgaatggaatccaattcatttaaca
aatacaggtgtgaaaattacttcaagtattgcttacacaccaacatcattccaacaaaca
gttgatttaatgggcagtggtcaattaaaacctcaaggaattattactggccgtattcaa
ttagatgatatcgttgaaaaaggctttgaagctttaacaaacgataaatcacaagctaaa
attttagtagaattaagcggcgagaaataa

DBGET integrated database retrieval system