KEGG   Lysinibacillus varians: T479_15000Help
Entry
T479_15000        CDS       T03062                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lgy  Lysinibacillus varians
Pathway
lgy00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    T479_15000
Enzymes [BR:lgy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     T479_15000
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     T479_15000
    1.1.1.-  
     T479_15000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_zinc_N_2 F420_oxidored ADH_N_assoc Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: AHN22488
UniProt: X2GQA0
Position
2988265..2989320
Genome map
AA seq 351 aa AA seqDB search
MKAARWYKARDIRVENIEEPSIASGKVKIKVHWTGICGSDLHEYAAGPIFIPVEQPHSIS
KDIAPIVMGHEFSGEVVEVGEGVTKVKIGDAVVVEPILSCGECAACKKGKYNICKQLGFH
GLSGGGGGLSEYTVVDDHMVHKMPAGLSYEQGALVEPAAVALHAVRQSKLKAGDKAAVFG
TGPIGLLVIEALRASGASEIYAVELSAERAAKAMELGATAVINPQDEDAVERLHALTNGG
VDVAFEVTGVPVVLQQAIDSTTFEGETIIVSIWESSASIQPNNIVLSERTVKGIIAYRDI
FPAVMELMTKGYFPADKLVTKRIGLDDVVTEGFEALMKEKNHIKILVNSQS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaagatggtataaagcaagagatatccgtgtagaaaacattgaggagcct
tccattgcatccggtaaagtaaaaattaaagtacattggacaggcatttgtggaagcgat
ttacatgagtatgcagcaggaccaatctttattccagttgaacagccacactctatcagt
aaagatatagcgcctattgtaatgggccatgagttttctggcgaggtagttgaagttggt
gaaggtgttacaaaagtaaaaattggagatgctgtcgttgtcgaacctattctctcttgt
ggcgaatgtgctgcttgtaaaaaagggaagtacaacatttgtaaacaactaggtttccac
ggactttctggcggcggtggcggattgtcagaatatactgtggtagatgaccacatggta
cacaaaatgccagcaggactttcttatgaacaaggtgctcttgtagaaccagccgcagta
gctttacatgcagttcgccaaagcaaattaaaagctggcgataaagccgcagtttttgga
acagggccaattggtcttcttgttatcgaagcattacgggcatctggagcttccgaaatt
tatgcggtagaactttcagcagaacgtgctgcaaaggcgatggaactaggagcaacagct
gttattaatccgcaagatgaagatgctgttgaacgtcttcatgccttaacaaatggcggt
gtggatgtggcatttgaagttactggcgttcctgttgttttacagcaagctattgactcc
actacgttcgaaggtgaaacaatcatcgtttcgatatgggaatcaagcgcttctatccag
ccaaataatattgtattatctgagcgtactgtgaaaggtattattgcctatcgagatatc
ttcccagctgttatggagttaatgaccaaaggatatttcccagcggacaaacttgtaact
aagcgcattgggctcgatgatgttgtaacagaaggctttgaagcgttaatgaaagagaaa
aaccatattaaaattcttgtcaattcacaaagctaa

DBGET integrated database retrieval system