KEGG   Lysinibacillus varians: T479_21885Help
Entry
T479_21885        CDS       T03062                                 

Definition
(GenBank) hypothetical protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
lgy  Lysinibacillus varians
Brite
KEGG Orthology (KO) [BR:lgy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lgy03009]
    T479_21885
Enzymes [BR:lgy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     T479_21885
Ribosome biogenesis [BR:lgy03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    T479_21885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 MetW Methyltransf_9 Methyltransf_23 Pox_MCEL Methyltransf_12 CMAS Methyltransf_32 PADR1
Motif
Other DBs
NCBI-ProteinID: AHN23581
UniProt: X2GXJ2
Position
complement(4320304..4321134)
Genome map
AA seq 276 aa AA seqDB search
MGAISKRAAGAALINANIELFACPICQESMQVYEQGRLTCTANHSFDIAKQGYVNMLTHG
ATSKYSKDLFESRKKIIDSGLYDPLEEKIAELIGQAKTVLDTGCGEGSHLARILSERDSI
GVGIDIAKEGILAAARHYPEQIWCVGDLAKSPFAKHSFDVILNILSPANYEEFKRLLTTG
GCVVKVVPQSGYLQQLRAQLYADSTKETYSNEQTVERFRECFTKVTVERITYTVPLASIL
VPALLEMTPMGWHKAQQAEVDVSEITIDVDILIGQV
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgggggccatttctaaacgagctgcaggagcggcattaataaatgcaaatattgagcta
tttgcttgtccaatttgtcaggagtccatgcaagtgtatgagcaagggaggttgacatgt
acagcaaaccattcttttgatatcgccaagcaaggctatgtcaatatgctaacgcatgga
gcaacctctaaatatagcaaggatctttttgaatcccgtaaaaagataattgatagtggg
ttgtacgatcctctagaggagaaaatagcagaattaataggacaagcaaaaacggtgctg
gataccggctgtggagagggttcgcatttagctcgcatactgtctgaaagagatagtatc
ggtgtaggcattgatattgcaaaagagggaatccttgctgctgctcgccattacccagag
caaatttggtgtgtaggagatttagcgaaaagtccctttgctaagcatagcttcgatgtc
atattaaatattctatccccagcaaattatgaagaatttaaacggctacttacaactgga
gggtgcgttgtaaaagtggttccgcaaagtggttatttgcaacaattacgagcgcagctt
tacgctgattcgactaaagaaacgtactccaatgagcaaacggtcgaacgctttcgtgaa
tgttttacaaaggttacagtagaacgcattacttatacggttccacttgcttcaatactc
gtaccagcattgctagaaatgacgccgatgggctggcacaaagcacagcaagcagaagtg
gatgtcagtgaaataacgattgatgttgatatcttaatcggtcaggtataa

DBGET integrated database retrieval system