KEGG   Lysinibacillus varians: T479_23050Help
Entry
T479_23050        CDS       T03062                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
lgy  Lysinibacillus varians
Pathway
lgy00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lgy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    T479_23050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lgy01007]
    T479_23050
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lgy03016]
    T479_23050
Enzymes [BR:lgy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     T479_23050
Amino acid related enzymes [BR:lgy01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   T479_23050
Transfer RNA biogenesis [BR:lgy03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    T479_23050
 Prokaryotic Type
    T479_23050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AHN23765
UniProt: X2GY93
Position
complement(4527771..4529171)
Genome map
AA seq 466 aa AA seqDB search
MSIQIFNSLTRQKETFVPLEEGKVKMYVCGPTVYNYIHIGNSRPVIVYDTVRRYFQYKGY
DVKFVSNFTDVDDKIIKAANELGEEVHELTDRFIAAYFEDVTALGCKKADVHPRVTDHMD
DIIDFIKVLIDKGYAYESAGDVYYRTRKFNGYGKLSHQSVDDLKIGARIEAGEKKDDALD
FALWKAAKPGEIYWESPWGNGRPGWHIECSVMAREHLGDTIDIHAGGQDLTFPHHENEIA
QSEAHNDTTFARYWMHNGYINIDNEKMSKSLGNFVLVNDIRKQIDPQILRFFMLSVHYRH
PINFAKDLVDAAATGLERIRTAYNNVKYRLSATASLGDCSEEWLRQIAQQKAQFEEAMDD
DFNTANAISVLFELARIANIYLNETNTDEKVLLTFIETFEVLGDVLGIEFAKEAELLDEE
IEALLQERVEARKNRDFARSDEIRDHLQAQGIILEDTRQGTRWKRG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcaaattttcaactcattaacaagacaaaaagaaacgttcgtaccgctagaa
gaaggaaaagttaaaatgtatgtttgcggtccgacggtttataactatattcatattggg
aattcacgtcctgtcattgtttatgatacggttcgacgctatttccaatataaaggttac
gatgtgaaattcgtctctaatttcacggatgtcgacgataagattattaaagcagctaat
gagctcggtgaggaagttcatgaacttacagatcgtttcattgccgcatattttgaagat
gtaactgcattaggttgcaaaaaggcagatgtccatcctcgtgtaacggatcacatggat
gatattattgactttattaaagtgttaatcgacaaaggttatgcatatgagtcagcgggc
gatgtctattaccgaactcgaaaattcaatggttacggaaaattatcacatcaatcggta
gatgatttgaaaattggtgcacgtatcgaagcgggcgagaaaaaggatgatgcattagat
ttcgcattatggaaagcagcaaagcctggcgaaatctattgggaaagtccttggggcaac
ggccgtcctggatggcatattgaatgctctgtgatggcgcgtgagcatttaggtgataca
attgatatacatgcaggtggtcaagatttaacattcccgcatcatgaaaatgaaatagcg
caatccgaagcgcataatgatacaacatttgcgcgttactggatgcataatggatatatt
aatatcgataatgaaaaaatgtcaaaatcccttggtaattttgtgctcgtgaacgatatc
cgtaaacaaatcgacccgcaaattttacgattctttatgttatctgttcactatcgccac
ccaattaactttgcaaaggatttagtagatgctgcagcaacaggtttagagcgtattcgt
actgcatataacaatgttaagtaccgcctatctgcaactgcaagtcttggcgattgctca
gaggaatggctccgtcaaattgctcaacaaaaggcgcagtttgaggaagcgatggatgat
gatttcaatacggcgaatgctatttcagtattatttgaattagcgcgtattgcaaatatt
tacttaaatgaaacaaatacggatgagaaagtgttattaacttttattgaaacttttgag
gtattaggtgacgtcttaggtattgaatttgctaaagaagctgaactactggacgaagaa
attgaagcattgttgcaagaacgcgtagaagcgcgcaaaaaccgtgactttgcccgttca
gatgaaattcgtgaccatttacaagcgcaaggtatcattttagaagatacacgccaaggg
acaagatggaaacgagggtaa

DBGET integrated database retrieval system