KEGG   Legionella hackeliae: LHA_1543Help
Entry
LHA_1543          CDS       T03809                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lha  Legionella hackeliae
Pathway
lha00071  Fatty acid degradation
lha00072  Synthesis and degradation of ketone bodies
lha00280  Valine, leucine and isoleucine degradation
lha00310  Lysine degradation
lha00362  Benzoate degradation
lha00380  Tryptophan metabolism
lha00620  Pyruvate metabolism
lha00630  Glyoxylate and dicarboxylate metabolism
lha00640  Propanoate metabolism
lha00650  Butanoate metabolism
lha00900  Terpenoid backbone biosynthesis
lha01100  Metabolic pathways
lha01110  Biosynthesis of secondary metabolites
lha01120  Microbial metabolism in diverse environments
lha01130  Biosynthesis of antibiotics
lha01200  Carbon metabolism
lha01212  Fatty acid metabolism
lha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LHA_1543
   00630 Glyoxylate and dicarboxylate metabolism
    LHA_1543
   00640 Propanoate metabolism
    LHA_1543
   00650 Butanoate metabolism
    LHA_1543
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LHA_1543
   00072 Synthesis and degradation of ketone bodies
    LHA_1543
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LHA_1543
   00310 Lysine degradation
    LHA_1543
   00380 Tryptophan metabolism
    LHA_1543
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LHA_1543
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LHA_1543
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LHA_1543
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lha04147]
    LHA_1543
Enzymes [BR:lha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LHA_1543
Exosome [BR:lha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LHA_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CEK10583
UniProt: A0A0A8UPC3
Position
I:1600544..1601863
Genome map
AA seq 439 aa AA seqDB search
MKLKSNLSGRDVYVVDGSRTPFLKAKNIGPFTGSDLAVAAGMPLLNRQPFLPSDLDEVII
GSAMPGPDEANIARVIALRLGCGEKVPGFTVMRNCASGMQALDNAAMQIANGRSNLVLAG
GTEAMSHAPLLFNQKMASWLASWFAAKSMGQRAVLMTKFRPSFLAPVIALLRGLTDPIVG
LNMGQTAEKVAYRFNITREQMDAFACESHRRLALAFAEGRMEEVTPIIDSRGRVYPQDDG
VRADSSVEKLAKLKPYFDKKYGMVTPGNSSQVTDGACLLLLASGDAVKKYNLPVIGRIVD
SQWAALDPSQMGLGPVHAATPIMERHNLKPVDFDCWEINEAFAAQVLGCLAAWDDEEYCR
TQLGLKQAMGAPSLGRLNMDGGAIAAGHPIGASGARIVLHVLQSLKHHNGARGMAAICIG
GGQGGAMYLERVTEVKGHE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaaatcgaatttaagcggcagagatgtatatgtagttgatggtagtcgaaca
ccatttcttaaagccaaaaatataggtccttttactggctcagatttggcggttgcggca
ggtatgccattgttaaatcgtcagccttttctaccctctgatttggacgaggtaatcatc
ggttctgccatgccaggtcctgacgaagcaaatattgccagagtaatagcactgcgtctt
ggttgtggagaaaaagttccagggtttactgttatgcgaaactgcgcttctggtatgcag
gctcttgataatgcagcgatgcaaattgccaatggcagaagtaatcttgttcttgctggt
ggtaccgaagcaatgagtcatgcgcctttattatttaaccaaaaaatggcgtcatggctt
gcgagctggtttgctgccaaaagcatgggacagcgtgcagtgttaatgactaaatttaga
ccctcatttcttgctcctgtaatcgcattattacgtggactaactgatcccattgtcggt
ttaaacatgggacaaaccgctgaaaaagtcgcttatcgcttcaacattactcgcgaacag
atggatgcttttgcttgtgaaagtcatcgacgtttagcgttagcatttgcagaagggcgc
atggaggaagtaacgccgattattgatagtagagggcgagtttatcctcaggatgatggc
gttcgtgcagattctagcgttgaaaaacttgcgaaactaaaaccctattttgataaaaaa
tatggaatggtgacgccaggtaacagctcacaagtaaccgatggtgcttgtttgctcctc
ctggcaagtggtgatgccgttaaaaaatataatttgcctgttataggacgcatagttgac
tcccaatgggcagcacttgatccatcacagatgggattagggcctgttcatgcagcaaca
ccgattatggagcgtcacaacttaaaacctgttgattttgattgctgggaaattaatgaa
gcatttgccgcccaggttttaggttgtttggcagcatgggatgatgaagaatattgccgt
actcagttaggtttaaaacaagcaatgggggcaccttcattaggtcgattaaatatggat
ggtggtgcgatagcagcgggtcatccaattggtgctagcggcgctcgtatagtattgcat
gtgctgcaatctctaaaacaccacaatggagcacgcggtatggccgctatctgcatcggt
ggaggacaagggggagcaatgtatctggaacgtgtgacagaggtaaaaggacatgagtaa

DBGET integrated database retrieval system