KEGG   Legionella hackeliae: LHA_2893Help
Entry
LHA_2893          CDS       T03809                                 

Gene name
ltaE
Definition
(GenBank) Low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
lha  Legionella hackeliae
Pathway
lha00260  Glycine, serine and threonine metabolism
lha01100  Metabolic pathways
lha01110  Biosynthesis of secondary metabolites
lha01120  Microbial metabolism in diverse environments
lha01130  Biosynthesis of antibiotics
lha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LHA_2893 (ltaE)
Enzymes [BR:lha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     LHA_2893 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CEK11887
UniProt: A0A0A8UXM6
Position
I:complement(3025709..3026737)
Genome map
AA seq 342 aa AA seqDB search
MKTIDLRSDTMTKPSHEMLQVMMQAEVGDDVWGEDPTAKHLEALIADKAGMEAAVFAPSG
TQSNLMGLMAHCERGDEYIVGQSAHTYRWEGGGAAVLGSIQPQPLDFASDGSLPLDKVTS
AIKPWDDHHPRTKLLCLENTTDGKVVPLDYLQKIPQFCQEHQLKSHLDGARVFNAVVKLQ
VPLIEITKNFDSVSICLSKGLGAPVGSVLCGSKELIKRARRWRKVLGGGMRQVGILAAAG
IYALEQNIERLNQDHENAFALASALAELDEVEVDEVSLQTNILFIRFKERYPELQDTLEK
KGVFFPKQANKQGFVRLVTHLDISKNDIAAIINEVKTFYKKC
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatagatttacgtagcgatacgatgactaaacctagtcatgaaatgctgcag
gtaatgatgcaagcagaagtcggcgatgatgtttggggagaagatcccactgcaaaacat
ctagaggctctaattgcagataaagcgggtatggaagcagctgtgtttgctccgtcagga
acgcaatccaatttaatgggattaatggctcattgtgagcgtggtgacgagtatattgtc
ggccaatctgcccacacttatcgatgggagggaggcggagcggccgtattgggaagtatt
caacctcaaccgctggacttcgcgagtgatggcagtcttcctttggataaagtgacatca
gccattaaaccttgggatgatcaccatccacgcacaaaattgctttgccttgaaaacaca
acggatggtaaggtagtcccgctcgattatcttcaaaagatccctcagttttgccaagaa
catcaattaaaaagtcacctggatggagctcgagtttttaatgctgtggttaaattgcaa
gttcctttaatagaaattaccaaaaactttgattctgtttcgatttgcctgtcgaaagga
ttaggggcacctgtcgggtcggtactttgcggcagtaaagaattaatcaaacgagcaaga
cgttggcgcaaggtgctcggcggtggtatgagacaagtcggtattttagctgcggcggga
atttatgcattggaacaaaatatagagcgtttaaatcaggatcatgaaaatgcgtttgct
ctcgcgagtgcattggcagaattggatgaagtggaggttgatgaagtttcactgcaaacc
aatattttatttattcgattcaaagagcgctatccagaattacaagatacgttagagaaa
aagggagttttttttccgaagcaagccaataaacaaggctttgtgcgtcttgttactcat
cttgatatttcaaagaatgatattgctgcaatcattaacgaggtaaaaactttttacaaa
aaatgttaa

DBGET integrated database retrieval system