KEGG   Lactobacillus helveticus KLDS1.8701: HUO_04375Help
Entry
HUO_04375         CDS       T03777                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lhd  Lactobacillus helveticus KLDS1.8701
Pathway
lhd00670  One carbon pool by folate
lhd01100  Metabolic pathways
lhd01120  Microbial metabolism in diverse environments
lhd01200  Carbon metabolism
Module
lhd_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lhd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HUO_04375
Enzymes [BR:lhd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     HUO_04375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS GTP_EFTU RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AJY61177
Position
821722..823383
Genome map
AA seq 553 aa AA seqDB search
MSTDIEIADAAKMQPITEIAAKLALKKDDFEQYGKYKAKINFPVKEISGKKHKLILVTGI
NPTPAGEGKSTVLVGLGDAMNQLGHQTTIAMREPSMGPVFGIKGGATGGGYSQIIPMEDM
NLHFTGDLHALTSANNTLAALIDNYIMRDNKLGLDPRRIIWRRVEDVNDRALRTVVTGLG
GLSQGVPRETGFDITAASEMMAILCLSESLHDLKRRIGRIVVGYSYEKKPITVDELGFTG
AITLLLKDAIKPNLVQSLGHTPAIIHGGPFANIAHGCNSVLATQIAMARSDYTVTESGFG
ADLGAEKFLDIKCRVLKKIPDAAVIVATARALKYNGGVDKKDLTKENISALKKGMANLAR
HVHNIQKYGIPVVVAINHFDSDTEAEIQTIKDACQEMDIKGIRVDAWAKGGNGTQDLAKE
VIALTKKTYDFIPLYDENDSIEEKITTIATKIYGAKRVVFSKKARKQMKQFAKFGWEKLP
VCIAKTQYSFTDDQTKLGAPTDFDFHIRDLVPKLGAGFIVALSGTIMTMPGLAKHPAAEN
MDIDDNGQISGLF
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagacattgaaattgctgatgctgccaaaatgcaacctattactgaaatcgct
gctaaacttgccttaaaaaaagatgattttgaacaatatggtaagtataaggctaagatt
aatttccctgttaaagaaatttcaggtaaaaaacataaattgattttagtaacaggaatt
aatccaactccggctggagaaggaaagtccacggttctagttggcttaggggatgcgatg
aatcaattaggccatcaaactacaattgctatgcgtgagccatcgatgggacctgttttt
ggaattaaaggaggtgcaactggtggcggttatagtcagattatcccaatggaggacatg
aaccttcattttactggcgacttacacgctttgacctctgccaacaatactttggctgcg
ctaattgacaattacattatgcgcgataataagttgggacttgatcctcgtaggattatt
tggcgtagggttgaagatgtgaatgatcgtgctttaaggactgttgttacaggattaggt
ggtttgagccaaggagttcctagagagaccggctttgatattactgcagcttcagaaatg
atggcaattctttgtttatctgaaagtcttcatgatttgaagcgaagaattgggcgaatt
gttgtcggctattcttatgagaaaaagccgattactgttgatgaattaggttttaccggt
gctattacgcttttattgaaagatgccattaaacctaatttagtccaatctcttgggcat
accccggcgattattcatggtgggccatttgctaatattgctcatggttgtaactctgtt
ttagcaacacaaattgcaatggctagatcagattataccgttactgaatcaggttttggc
gcagatcttggtgcagaaaaatttttagatattaaatgcagggtgctaaagaaaataccc
gatgcagcggtcattgtagcaacggcaagagctttgaaatataacggtggcgtagataaa
aaagatctaactaaagaaaacatttctgctttgaagaaagggatggcgaatttagctcgc
catgttcacaacatccaaaagtatggcattccagttgttgtggcaattaatcattttgat
tctgatactgaagccgaaattcaaactattaaagatgcttgtcaagaaatggatataaag
ggtattagagttgatgcttgggctaagggcggcaacggcacacaagatttagctaaagaa
gttattgccttaactaaaaaaacgtatgattttattcccttatatgatgaaaatgattca
atagaagaaaaaattactactatagctaccaaaatttatggtgctaaacgtgttgttttt
tctaaaaaagcaagaaagcaaatgaaacaatttgctaaatttggctgggaaaaattacca
gtatgtatcgctaaaacccaatattcatttacagacgaccaaactaagttaggtgctcca
acggattttgattttcatattcgtgatttagttccaaaacttggagcaggctttatcgtt
gctttatccggtaccattatgaccatgccagggttggctaagcatcctgcagcagaaaat
atggatattgatgataatggccaaattagtggattattttaa

DBGET integrated database retrieval system