KEGG   Lactobacillus helveticus DPC 4571: lhv_0662Help
Entry
lhv_0662          CDS       T00625                                 

Definition
(GenBank) Hydroxymethylglutaryl-coA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
lhe00900  Terpenoid backbone biosynthesis
lhe01110  Biosynthesis of secondary metabolites
lhe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lhe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lhv_0662
Enzymes [BR:lhe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     lhv_0662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ABX26813
UniProt: A8YU75
Position
642081..643292
Genome map
AA seq 403 aa AA seqDB search
MKFYQLKPEQRREILQSEGINLEDIDDQVLNRLDKLSENVVGQLRLPLGVVQNFLLNGQS
YMVPMAVEEPSVVAAANHGAHIFARNGGVKATSKRTGIYGQIVLKVNHDFSLPDLKKKFP
DLIDLANKEFASLIRHGGGTRSIEAERKGDLVYLKVLVDPAEAMGANKTNSILEFLAAKL
KQFPGIEEKLFAILSNYPSQLTKATVTLDPKTMGGRKVAERVALLSKIGYEDPYRAVTNN
KGIMNGVDAVLIATGNDYRAIESATAVLASQDGHYRSLSKWTMQDGKLVGELTLPMAIGV
VGGSIKARKDVQQSFAILGKEINSAKLAEIIVSVGLANNLAALLAISTVGIQAGHMKLQA
RNIVSELDASDEEKKKVLAQIIKQKDYSESYAQAVLKQIREGK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttatcaattgaagcctgagcaaaggcgagaaattttacaatctgaaggaata
aatttagaagatattgatgatcaggttcttaatcgcttagacaaattaagcgagaatgtt
gtgggacaattgcgtttgcctttaggagtcgtgcaaaattttctgctaaatgggcaatcg
tatatggtccctatggctgtagaagaaccttcagttgtagcagctgccaatcatggtgct
catatttttgcacgtaatggcggagttaaggcaactagcaagcgcacaggaatttatggt
caaattgttttaaaggtaaatcatgatttttctttaccagatttaaaaaagaaatttccg
gatttaatcgatttggctaacaaagaatttgctagtttgattcgtcatggtggtggaact
agatcaattgaagctgaacgaaaaggtgatttagtttatcttaaagttttggttgatccc
gctgaagcaatgggagcaaataagacgaattcgatcttggaatttttagcagctaagtta
aaacaatttccaggcattgaagaaaaattatttgcgattttgtccaattatcctagtcaa
ttgactaaagcgacggtgactcttgatcctaagacgatgggcggtaggaaagtggctgaa
cgcgttgctttgcttagcaaaattggttatgaagatccatatcgagcagtaaccaataat
aaaggaatcatgaacggcgttgatgccgtgctgattgcaacaggaaatgactatcgtgca
attgaaagtgcgactgcagttttagctagtcaggatggacattatcgcagtctgtctaaa
tggacgatgcaagatggcaagctagttggtgaactcactttgccgatggctattggagta
gttggcggctcgattaaagcgcgcaaggatgtccagcagagctttgctattttaggtaag
gaaataaatagtgctaagttagctgaaattattgtcagtgttggattagctaataattta
gcagcgctgctagcaatttctactgtgggaattcaggctggtcacatgaaattgcaagca
cgcaatattgtttcggaacttgatgctagtgatgaggaaaagaaaaaggtattagcgcaa
ataattaagcaaaaggattattctgagagttatgctcaggctgttttaaagcaaataaga
gagggaaaataa

DBGET integrated database retrieval system