KEGG   Lactobacillus helveticus DPC 4571: lhv_1698Help
Entry
lhv_1698          CDS       T00625                                 

Definition
(GenBank) Fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
lhe00010  Glycolysis / Gluconeogenesis
lhe00030  Pentose phosphate pathway
lhe00051  Fructose and mannose metabolism
lhe00680  Methane metabolism
lhe01100  Metabolic pathways
lhe01110  Biosynthesis of secondary metabolites
lhe01120  Microbial metabolism in diverse environments
lhe01130  Biosynthesis of antibiotics
lhe01200  Carbon metabolism
lhe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lhv_1698
   00030 Pentose phosphate pathway
    lhv_1698
   00051 Fructose and mannose metabolism
    lhv_1698
  09102 Energy metabolism
   00680 Methane metabolism
    lhv_1698
Enzymes [BR:lhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     lhv_1698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase ThiG CTNNBL BKACE His_biosynth PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABX27591
UniProt: A8YWT0
Position
complement(1665802..1666713)
Genome map
AA seq 303 aa AA seqDB search
MAYFDNGNEIFKEARKHHYAVGAYNTNNLEWTRAELRAAEETRTPLLIQVSTGAAKYMGG
YKFVKDMVADQMDSMNISVPVILNLDHGDFESAKECIALGYSSVMFDGHALPTEENLAKT
KEIIKLAHERGISVEAEIGKIGENQGGGELASVEDAKKFVAAGVDKLACGIGNIHGVYPA
DWKGLNFDRLKEIAEAVPDTPLVLHGGSGIPEDQVKKAIKLGIAKININTEFQLAFQDAT
RKYIEAEKDLDKKNKGYDPRKLLLPGAEAITAKMKEMISWMGTKTIDDELKDASFDRSSL
NEE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcttattttgacaacggtaatgaaatctttaaagaagctcgtaaacaccactacgct
gtaggtgcttacaacactaacaacttggaatggactcgtgcagaattacgtgctgcagaa
gaaactagaactccattacttatccaagtttcaactggtgctgctaagtacatgggtggt
tacaagttcgttaaggacatggtagctgaccaaatggattcaatgaacatctcagttcca
gttatcttgaacttggaccacggtgactttgaatcagctaaggaatgtattgcacttggt
tactcatcagttatgtttgatggtcacgcacttccaactgaagaaaacttagctaagact
aaggaaatcatcaagttagctcacgaacgtggtatttcagttgaagctgaaatcggtaag
atcggtgaaaaccaaggcggcggtgaattagcatctgttgaagatgctaagaagttcgtt
gcagctggcgttgacaagcttgcttgtggtattggtaacatccacggtgtttacccagca
gactggaagggcttgaacttcgaccgtcttaaggaaattgctgaagctgttcctgacact
ccacttgtattgcacggtggttcaggtattcctgaagaccaagttaagaaggctattaag
cttggtattgctaagatcaacatcaacactgaattccaattagcattccaagatgctact
cgtaagtacatcgaagctgaaaaggaccttgacaagaagaacaagggttacgacccacgt
aagttattattgccaggtgctgaagcaattactgctaagatgaaggaaatgatttcttgg
atgggtactaagaccatcgatgacgaacttaaggatgcttcattcgaccgttcatcatta
aacgaagaataa

DBGET integrated database retrieval system