KEGG   Lactobacillus heilongjiangensis: JP39_08770Help
Entry
JP39_08770        CDS       T04057                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lhi  Lactobacillus heilongjiangensis
Pathway
lhi00071  Fatty acid degradation
lhi00072  Synthesis and degradation of ketone bodies
lhi00280  Valine, leucine and isoleucine degradation
lhi00310  Lysine degradation
lhi00362  Benzoate degradation
lhi00620  Pyruvate metabolism
lhi00630  Glyoxylate and dicarboxylate metabolism
lhi00640  Propanoate metabolism
lhi00650  Butanoate metabolism
lhi00900  Terpenoid backbone biosynthesis
lhi01100  Metabolic pathways
lhi01110  Biosynthesis of secondary metabolites
lhi01120  Microbial metabolism in diverse environments
lhi01130  Biosynthesis of antibiotics
lhi01200  Carbon metabolism
lhi01212  Fatty acid metabolism
lhi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lhi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JP39_08770
   00630 Glyoxylate and dicarboxylate metabolism
    JP39_08770
   00640 Propanoate metabolism
    JP39_08770
   00650 Butanoate metabolism
    JP39_08770
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JP39_08770
   00072 Synthesis and degradation of ketone bodies
    JP39_08770
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JP39_08770
   00310 Lysine degradation
    JP39_08770
   00380 Tryptophan metabolism
    JP39_08770
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JP39_08770
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JP39_08770
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JP39_08770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lhi04147]
    JP39_08770
Enzymes [BR:lhi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JP39_08770
Exosome [BR:lhi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JP39_08770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALB29439
UniProt: A0A0K2LDR2
Position
complement(1947288..1948442)
Genome map
AA seq 384 aa AA seqDB search
MDPIVIIDAKRTAIGKFRGQFADMTAVELGSQLVKKLLSQNKVNPKMVDQFIFGNVYQTG
MGQNTARQIELNVDGRVDATAMTVNQVCGSGMKAIYEGVSAITMGNAEIVVAGGVESMSN
APFYAPRTGKMEVSPKLSDSLFNDGLNDAFNHLPMGITAENVARKYHVTREQQDKFAFDS
HQKAHKAQAKLAKEIIPIEVNGEEITTDQSIRPTTTLEQMGQLRTVFDKKGTVTAGNSSP
INDGAAAVILMRESRAKELGLNYVAEITGYTEIGIDPDYMGYAPYYAINKYFDRYKTTVD
DYDLFEVNEAFAAQAVAVSRDLKLPEDRLNIYGGAIALGHPLGATGTRMIATLINSLQQE
GKQNGLASLCIGGGMAMAMGIKLL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatccgattgtaattatagatgcaaaaagaactgctattggcaaattccgcggacaa
tttgctgatatgacggcggttgagttgggtagtcaacttgttaaaaaactacttagccaa
aataaagttaaccctaagatggttgatcaatttatttttggaaatgtttatcaaactggt
atgggtcaaaatacagctcgtcaaatcgagttaaatgtagacggacgtgtcgacgcaacg
gccatgaccgtcaatcaagtttgtggttccgggatgaaagccatttatgaaggtgtctcg
gctatcactatgggtaacgcagaaattgttgttgccggtggtgtagaaagcatgtcaaat
gcaccattttatgcaccaagaacaggcaagatggaagttagtcctaagttgtcagatagt
ttgttcaatgatggattgaacgatgctttcaatcatttgccaatgggtatcacggctgaa
aatgtagctcgtaaatatcacgtaactcgtgaacaacaagataaatttgcttttgattca
catcaaaaagcacataaggctcaagcaaaattagccaaagaaattattccgattgaagtt
aatggtgaagaaattaccactgatcaatcgattcgtccaacaacgactttggaacaaatg
ggtcaattacgaactgttttcgataaaaaaggaacagttactgctggaaattcatcgcca
atcaacgatggtgctgctgccgtaattttgatgcgtgaaagtcgtgctaaagaattaggt
ctcaattatgtggctgaaattactggttatacagaaatcggaatcgaccccgattatatg
ggttatgcaccatattacgccatcaacaaatactttgaccgctataagacaacagttgat
gactacgatttatttgaagtcaacgaagcctttgcggctcaagcagttgcggttagtcgt
gacctcaagttacctgaggaccgtttgaatatttatggtggagcgattgctttagggcat
ccacttggcgctacaggaactcgaatgattgctactttgatcaattcattgcaacaagaa
ggcaagcaaaatggcttagcatcactttgtatcggtggtggtatggcaatggctatggga
atcaaattactatga

DBGET integrated database retrieval system