KEGG   Laribacter hongkongensis: LHK_00158Help
Entry
LHK_00158         CDS       T00884                                 

Gene name
ilvC
Definition
(GenBank) IlvC
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00290  Valine, leucine and isoleucine biosynthesis
lhk00770  Pantothenate and CoA biosynthesis
lhk01100  Metabolic pathways
lhk01110  Biosynthesis of secondary metabolites
lhk01130  Biosynthesis of antibiotics
lhk01210  2-Oxocarboxylic acid metabolism
lhk01230  Biosynthesis of amino acids
Module
lhk_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
lhk_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:lhk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    LHK_00158 (ilvC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LHK_00158 (ilvC)
Enzymes [BR:lhk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     LHK_00158 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC F420_oxidored NAD_binding_2 2-Hacid_dh_C AdoHcyase_NAD CoA_binding NAD_binding_7 Shikimate_DH ApbA PDH GFO_IDH_MocA Mur_ligase Rossmann-like ThiF
Motif
Other DBs
NCBI-ProteinID: ACO73154
UniProt: C1DA41
Position
160849..161865
Genome map
AA seq 338 aa AA seqDB search
MKVYYDKDADLSIIRDKKVAIIGYGSQGHAHAQNLKESGVDVIVGLRKDGASWKKAEAAG
HTVKEVGEAVKTADVVMILLPDETQPDVYRNDIAPNLKKGAALAFAHGFNIHYNQIVPPA
DIDVIMIAPKGPGHTVRSEFLKGGGVPSLIAVYQDHSGRARDVALSYAAANGGTKGGVIE
TSFREETETDLFGEQAVLCGGAVELVKAGFETLTEAGYAPEMAYFECLHELKLIVDLMYE
GGIANMNYSISNNAEYGEYVTGPEVITAASKEAMKKALYRIQSGEYAKMFILEGKTNYPS
MTARRRLTADHPIEKVGAELRAMMPWIAKNKLVDQSKN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttattacgacaaggacgccgacctttccatcatccgtgacaagaaagtggcc
atcatcggttacggttcgcagggccatgcccacgcccagaacctgaaggaatccggtgtc
gatgtcatcgtcggcctgcgcaaggacggtgcctcgtggaaaaaggccgaagcagccggc
cacacggtcaaggaagtcggcgaagcggtcaagacggccgacgtggtgatgatcctgctg
ccggacgaaacccagccggacgtctaccgcaacgatatcgccccgaacctcaagaagggt
gccgcgctggcgttcgcccacgggttcaacatccattacaaccagatcgtgccgccggcc
gatatcgacgtgatcatgatcgccccgaagggtccgggccataccgtgcgctcggaattc
ctcaagggtggcggcgtgccgtcgctgatcgccgtgtaccaggaccactccggtcgcgcc
cgtgacgtcgccctgtcgtacgctgctgccaacggcggcaccaagggtggcgtgatcgag
acttcattccgcgaagaaaccgaaaccgacctgttcggcgagcaggccgtgctgtgcggt
ggtgccgtcgagctggtcaaggccggtttcgaaacgctgaccgaagccggttacgctccg
gaaatggcctatttcgagtgcctgcacgaactgaagctgatcgtggacctcatgtacgaa
ggcggcatcgccaacatgaactactcgatctccaacaacgccgaatacggcgagtacgtg
acaggtccggaagtgatcaccgctgccagcaaggaagcgatgaaaaaggcgctgtaccgc
atccagtccggtgaatacgccaagatgttcatcctcgaaggcaagaccaactacccgagc
atgaccgcccgtcgtcgcctgaccgccgatcacccgatcgagaaggtgggtgccgaactg
cgcgccatgatgccgtggattgccaaaaacaagctggttgaccagtcgaagaactga

DBGET integrated database retrieval system