KEGG   Laribacter hongkongensis: LHK_00206Help
Entry
LHK_00206         CDS       T00884                                 

Definition
(GenBank) Probable acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00071  Fatty acid degradation
lhk00072  Synthesis and degradation of ketone bodies
lhk00280  Valine, leucine and isoleucine degradation
lhk00310  Lysine degradation
lhk00362  Benzoate degradation
lhk00380  Tryptophan metabolism
lhk00620  Pyruvate metabolism
lhk00630  Glyoxylate and dicarboxylate metabolism
lhk00640  Propanoate metabolism
lhk00650  Butanoate metabolism
lhk00900  Terpenoid backbone biosynthesis
lhk01100  Metabolic pathways
lhk01110  Biosynthesis of secondary metabolites
lhk01120  Microbial metabolism in diverse environments
lhk01130  Biosynthesis of antibiotics
lhk01200  Carbon metabolism
lhk01212  Fatty acid metabolism
lhk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lhk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LHK_00206
   00630 Glyoxylate and dicarboxylate metabolism
    LHK_00206
   00640 Propanoate metabolism
    LHK_00206
   00650 Butanoate metabolism
    LHK_00206
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LHK_00206
   00072 Synthesis and degradation of ketone bodies
    LHK_00206
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LHK_00206
   00310 Lysine degradation
    LHK_00206
   00380 Tryptophan metabolism
    LHK_00206
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LHK_00206
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LHK_00206
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LHK_00206
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lhk04147]
    LHK_00206
Enzymes [BR:lhk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LHK_00206
Exosome [BR:lhk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LHK_00206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACO73202
UniProt: C1DAM1
Position
complement(197504..198691)
Genome map
AA seq 395 aa AA seqDB search
MSSTDPVVIVAAARTPIGGLQGSLSSLPASALGAAALAEVARRASIASEAVDEVIMGCVL
PAGQGQAPARQAALTAGLSPHVPCTTINKMCGSGMKAVMQGHDALLAGSARIVLAGGMES
MSNAPYLLPKMRTGQRLGHGVTQDHMFLDGLEDAYEKGTLMGVFAERCARHYGFGREQQD
DYARRSLERALHAQQTGAFAAEIVGVDLVQRHGHTRIDQDEQPLTARPERIASLKPAFAS
DGTVTAANSSSISDGAAALALMRQSEALRRGLTPLARIAGHASFAHEPPWFTTAPVFAVR
KLLQKLQWQPQDVDLYEINEAFAVVALAALHELELDPARVNVHGGACALGHPIGASGARI
LVTLLHALEHRQMQRGVACLCIGGGEATAVAIERL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaccgatccggtcgtgattgttgccgctgcccgtacccccatcggcggtctg
cagggcagcctgtccagcctgcccgccagcgctctgggagccgcagccctggccgaagtc
gcccgccgcgccagcatcgccagcgaagcggtcgacgaagtcatcatgggctgcgtactg
ccggccgggcaggggcaggctccagcgcgtcaggctgccctgacagcaggactgtcgccg
catgtgccctgcaccacgatcaacaagatgtgcggctccggcatgaaggccgtgatgcag
ggacacgacgccctgctggccggcagcgcccgcatcgtgctggcaggcggcatggaaagc
atgtcgaacgcaccttacctgttgccgaaaatgcgtaccggccagcgtctggggcacggc
gtgactcaagaccacatgttcctcgacgggctggaggacgcctacgaaaaaggcaccctg
atgggtgtgtttgccgaacgctgcgcccggcactacggctttggccgcgagcagcaggac
gactatgcccggcgctcgctcgaacgcgccctgcacgcacagcagaccggtgcgtttgca
gccgaaatcgtcggcgtcgatctcgtacagcgccatggccacacccgcatcgaccaagac
gaacaaccgctcacggcccgcccggagcggatcgccagcctgaagccggcctttgccagc
gacggcaccgtcaccgcggccaactccagctccatttccgatggagctgctgccctggca
ctgatgcgccagtcggaagccctgcgccggggcctgactcccctggcccgcattgccggt
catgccagctttgcccatgagccgccttggtttaccaccgctcccgtgttcgccgtccgg
aaactgctgcaaaaactgcaatggcagccgcaggacgtcgacctgtacgaaatcaacgaa
gcctttgccgtcgtggcactggccgccttgcacgaactggagctggatcctgcccgggtc
aacgtccatggcggcgcctgcgccctcggtcacccgatcggcgcctccggcgcccgcatt
ctggtcaccctgctgcatgcgctggaacaccggcagatgcagcgcggcgtggcctgcctg
tgcatcggtggcggcgaagctacggccgtagccatcgaacggctctga

DBGET integrated database retrieval system