KEGG   Laribacter hongkongensis: LHK_00350Help
Entry
LHK_00350         CDS       T00884                                 

Gene name
dadB
Definition
(GenBank) DadB
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00473  D-Alanine metabolism
lhk01100  Metabolic pathways
lhk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lhk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LHK_00350 (dadB)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    LHK_00350 (dadB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lhk01011]
    LHK_00350 (dadB)
Enzymes [BR:lhk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     LHK_00350 (dadB)
Peptidoglycan biosynthesis and degradation proteins [BR:lhk01011]
 Precursor biosynthesis
  Racemase
   LHK_00350 (dadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACO73345
UniProt: C1DBE8
Position
331282..332361
Genome map
AA seq 359 aa AA seqDB search
MTRPIRATLDLAAIRHNYQQAKACSPESFAFAVIKADAYGHGYEQVAAALAVWPTVLPSS
TSSRARTLREAGLRQPILLLEGCFDRAELEEAARLQLTVPFHAAHQFDWLKQGSLPAPLE
VMLKLNTGMNRLGFRPDEAPRAAAWLQARNDIRLAGLMTHFATADGDPGIAAQLSRFDEV
NASLGLPSCVANSAALMRHPASRRQYVRPGIMLYGASPFADQSAAELGLRPAMRLEADII
GVQSLQAGDAVGYGATFVADRPMRIGVVACGYADGYPRVAPAGTPCAIGGQPARLVGRVS
MDMLTIDLTSLPQAGVGDRVTLWGGDGVSIDDVATAAGTIGYELMCALAPRVPRRVVGA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtccgatccgcgcgaccctcgatctggccgctatccgtcacaattatcaacaa
gccaaagcctgttctccggaaagttttgcctttgccgtcatcaaggccgatgcctacggc
cacggttatgaacaggtggcggcagcgctggccgtctggccgacggttttgccctcatca
acatcgagcagggcccgtaccttgcgtgaggccggtctgcgacagccgatcctgttgctg
gagggctgctttgaccgtgccgaactggaggaagctgcccgtctgcaactgacggtgccg
tttcatgccgcgcaccagttcgactggctgaagcagggcagcttgccggctccgcttgaa
gtcatgctcaagctcaataccggcatgaaccggctgggattccgccccgacgaggcgcca
cgcgccgcagcctggttgcaggcacgcaacgacatccgtctggcggggctgatgacccac
tttgccacggccgacggcgaccccggcattgccgcccagttgtcccgctttgacgaagtc
aatgcctcgctcggcctgccgtcgtgcgtggccaattcggcggcgctgatgcgtcatccg
gccagccggcgtcagtatgtgcgtccaggcatcatgctttacggtgccagtccgtttgcc
gaccagtcggccgctgaactggggctgcggccggccatgcggctggaggctgacatcatt
ggcgtgcagtcgctgcaagccggagatgccgtcggttatggcgcgacattcgtggccgac
cggccgatgcgcattggtgtggtagcctgtggttatgctgatggctatccgcgtgtggcg
ccggccggtacgccctgtgcgatcggcggtcagcctgcccggctggtggggcgggtgtcg
atggacatgcttaccattgatctcaccagtctgccgcaggctggtgtcggagaccgggtg
acgctgtggggcggtgatggtgtgtcgatcgacgacgtggccacggcagccgggaccatc
ggttatgaactgatgtgcgctttggcgccacgtgtgccgcgtagggtggttggggcctga

DBGET integrated database retrieval system