KEGG   Laribacter hongkongensis: LHK_00456Help
Entry
LHK_00456         CDS       T00884                                 

Gene name
kguA
Definition
(GenBank) KguA
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00230  Purine metabolism
lhk01100  Metabolic pathways
Module
lhk_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LHK_00456 (kguA)
Enzymes [BR:lhk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LHK_00456 (kguA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 AAA_22 AAA_16 AAA_33 cobW Thymidylate_kin AAA_29 AAA_30 AAA_23 ABC_tran NTPase_1 AAA_25 RsgA_GTPase IstB_IS21 MobB AAA_18 CbiA
Motif
Other DBs
NCBI-ProteinID: ACO73451
UniProt: C1DC34
Position
425785..426411
Genome map
AA seq 208 aa AA seqDB search
MQVQGGNIFIVTAPSGAGKTTLVAALLAADRQVQLSVSYTTRPPREGEVHGRHYHFIDRA
TFEAMIGRGEFLEHADVYGNYYGTSETWIREQLSTGRDILLEIDWQGAEQVRKTFPEAIG
VFILPPSVEVLEHRLRSRGKDDEATIQKRMASARGEIDHVSNFDYVVINEVLDEAVRDLV
SIVRAERLRTLRQQTRHARRIAAMQSQG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgcaaggcggcaacatcttcatcgtcaccgcgccctccggggccggcaaaacc
acgctggtggcagccctgctggcggctgaccgccaggtgcagctttccgtgtcctacacc
acgcgcccgccgcgcgagggtgaggtgcatggccggcattaccatttcatcgaccgtgcc
acgtttgaggccatgatcggccgcggcgagttcctcgagcatgccgacgtgtacggcaac
tactacggcaccagcgaaacctggatccgcgagcagttgtccaccggacgcgacatcctg
ctggaaatcgactggcagggtgccgaacaggtgcgcaagaccttccccgaggccatcggc
gtctttatcctgccgccctcggtcgaagtactggagcaccgcctgcgcagccgcggcaag
gatgatgaagccaccatccagaaacgcatggcgtcagcgcgcggcgagatcgaccatgtc
agtaattttgactatgttgtcatcaatgaggtgctcgacgaagcggtgcgggacctcgtc
tccatcgtccgcgccgagcgcctgcgtacactgcgccagcagacacggcatgcccgccgg
atcgctgccatgcagtcgcagggctga

DBGET integrated database retrieval system