KEGG   Laribacter hongkongensis: LHK_00748Help
Entry
LHK_00748         CDS       T00884                                 

Gene name
glyS
Definition
(GenBank) GlyS
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lhk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LHK_00748 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lhk01007]
    LHK_00748 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lhk03016]
    LHK_00748 (glyS)
Enzymes [BR:lhk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     LHK_00748 (glyS)
Amino acid related enzymes [BR:lhk01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   LHK_00748 (glyS)
Transfer RNA biogenesis [BR:lhk03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LHK_00748 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: ACO73741
UniProt: C1D4E7
Position
722715..724793
Genome map
AA seq 692 aa AA seqDB search
MTTLLVELFTEELPPKALKRLGESFADVIRAELARAGLLEDNAVATAWASPRRLAVSIDH
VRATAPDRDVTEKIMPVAVALAADGQPSPALRKKLEARGIALDAVAQFERRPDGKHETFF
YTYTAAGARLADELPRAVQESVRKLPIPKVMHWGDSDVTFVRPVHKLVALYGSEIIDCEV
LGLFSDRITGGHRFLSEGDISLPDAESYARVLEQEGRVVAGFDDRRERIRAGLDAAARRL
NATIAADDALLDEVTALVEWPVVLEAGFEAEFLKVPQECLILTMQQNQKYFPLLDANGRL
MNRFLLVSNLETADPSHIIKGNERVLRARLSDAKFFFEQDQKQKLEARIPRLADVVYHNQ
LGSQLERTERLAVLAGDIARALGADAAIAERAARLAKADLLTDMVGEFPELQGVMGRYYA
LIDGELPIVADAIEGHYHPRFAGDSLPDGDIATAVALADKLEMLTGIWGIGLVPTGDKDP
FGLRRQALGVMRMLMNARLDLKALLERAVATFPAGKLAADTAPALYVFMLERLKNLLTAD
AATRADEVDAVLALEPGHFDEVPAVLAAVAAFRALPEAAALAAANKRVKNILKKVEGELP
TGVDAALLTEAAETELWQSIDAVLPTVEAAFAARDYATALSRLAVLKVPVDAFFDGVMVM
ADDAAVRANRLALLARLAGLFNRVADISLLAE
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctgctcgttgaactgtttaccgaagagctgccgcccaaggcgctcaagcgt
ctgggcgagagcttcgccgacgtgatccgtgccgaactcgcccgggccggcctgctggag
gacaacgctgtcgccacggcctgggccagcccgcgccggctggccgtcagcatcgaccat
gtccgcgccaccgcccctgaccgcgatgtcaccgaaaagatcatgccggtcgccgttgcc
ttggccgccgacggccagcccagcccggccttgcgcaaaaagcttgaagcccgcggcatt
gcactggacgccgtggcgcagttcgaacgtcgtccggacggcaagcacgaaaccttcttc
tacacctacaccgcagccggagcccggctggcagacgaattgccgcgcgccgtgcaggaa
tcggtccgcaagctgccgatcccgaaggtcatgcactggggcgacagcgacgtcaccttc
gtgcggccggtgcacaagctggtggccctgtacggcagcgaaatcatcgactgcgaagtg
ctgggactgttctccgaccgcatcaccggcggccaccgtttcctgtccgaaggcgacatc
agcctgccggatgccgaatcctacgcacgggtgctggaacaggagggccgtgtcgtagcc
ggttttgatgaccgtcgcgagcgtatccgggccggactggatgccgcggcccggcgcctg
aacgccaccatcgccgccgacgatgccctgctggacgaagtgactgcgctggtcgaatgg
ccagtggtgctggaagccggctttgaggccgaattcctcaaggtgccgcaggaatgcctg
atcctcaccatgcagcagaaccagaagtacttcccgctgctggacgccaacggccggctg
atgaaccgcttcttgctggtgtcgaacctggaaaccgccgatccgtcgcacatcatcaag
ggcaacgaacgcgtgctgcgcgcccgcctgtccgatgccaagttcttcttcgagcaggac
cagaagcagaagctcgaagcccgcattccgcgtctggccgacgtggtgtaccacaaccag
ctgggcagccagctggagcgcaccgaacggctggccgtgctggccggtgacattgcccgc
gccctcggtgccgatgccgccatcgccgaacgcgccgcccggctggccaaggccgacctg
ctgaccgacatggtgggcgaattccctgagctgcaaggcgtcatgggccgttattacgcc
ctgatcgacggcgagctgccgattgttgccgatgccatcgaaggccactaccacccgcgc
tttgccggtgacagcctgcccgacggcgacatcgccaccgccgtggcactggccgacaag
ctggaaatgctgacaggcatctggggtatcggtctggtgccgaccggcgacaaggacccg
ttcggcctgcgccggcaggcgctgggcgtgatgcgcatgctgatgaacgcccggctggac
ctcaaggccctgctggaacgtgccgtggctaccttcccggccggcaagctggccgctgac
accgcgccggcgctgtacgtgttcatgctggagcgcctgaagaacctgctgaccgccgat
gccgccacccgtgccgacgaagtggatgccgtgctggcgctggagccggggcattttgac
gaagtgccggccgtgctggctgccgtggccgcattccgcgccctgccggaagccgccgca
ctggctgccgccaacaagcgggtcaagaacatcctcaagaaggttgaaggtgagctgccg
accggtgtggatgccgccctgctgaccgaagccgccgaaaccgaactgtggcagtccatc
gacgccgtgctgccgaccgtcgaagcagcctttgccgcccgtgattacgccacggccctc
agccgcctcgccgtgctcaaggtaccggtggatgccttctttgacggcgtgatggtgatg
gctgacgatgccgccgtacgggccaaccggctggcactgctggcccggctggccggcctc
ttcaaccgcgtggccgacatttcgctgctggcggaataa

DBGET integrated database retrieval system