KEGG   Laribacter hongkongensis: LHK_01553
Entry
LHK_01553         CDS       T00884                                 

Definition
(GenBank) hypothetical protein
Organism
lhk  Laribacter hongkongensis
SSDB
Motif
Pfam: LPD22
Other DBs
NCBI-ProteinID: ACO74541
UniProt: C1D7V1
Position
1496962..1497459
AA seq 165 aa
MNRLDNYLNTLNQQRNDQLAGSLRDALQVNPDDYAKTVRLAKAAGVEVEAVPLYADVAQE
AQYLEGIGFRSLWKDSPKTAEFLSDARNARLAHDDVANLSVLEKLARSAGAGLTAANAGL
WGMAQAGTELLVKPVTGALAGLGVLPEDVGGRMGRVVFPDAPDPG
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaatcgtctggacaattatctgaatactctgaaccagcagcgtaacgaccagctggcc
ggctccttgcgtgatgccctgcaggtcaatcctgatgactacgccaaaaccgtcaggctg
gccaaggctgccggcgtcgaggttgaggccgtgcctctttacgccgatgtggcacaggaa
gcccagtatctggaggggattggatttcgctcgctctggaaagactcaccgaagaccgct
gaattcctgagcgatgccaggaatgccaggctggctcatgatgatgtggcaaacctgtcg
gtgctggaaaagctggcccggtctgccggggcgggtctgaccgccgccaatgccggtctg
tgggggatggcacaggccggaacagaactgctggtgaagcctgttacaggcgcactggcc
ggtctgggtgttttgccagaggacgtgggtggccggatgggccgagtcgttttcccggat
gcgccggatccaggatga

DBGET integrated database retrieval system