KEGG   Laribacter hongkongensis: LHK_01909Help
Entry
LHK_01909         CDS       T00884                                 

Gene name
dfp
Definition
(GenBank) Dfp
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00770  Pantothenate and CoA biosynthesis
lhk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LHK_01909 (dfp)
Enzymes [BR:lhk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     LHK_01909 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     LHK_01909 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Glyco_trans_4_4 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ACO74893
UniProt: C1D8V3
Position
1814464..1815636
Genome map
AA seq 390 aa AA seqDB search
MQRHFLVGVTGGVAAYKTCELVRLLVKAGHTVDVVMTEAATRFVGPTTFQALSGRPVFLS
QWDERPSNAMAHIELTRRADAFLIAPATADMLAKLAHGLCDDLVSTLAAARTCPLIVAPA
MNKQMWDNPPNQRNVTRLQADGVTVFGPGSGAQACGETGDGRMLEPEDLFDLLQGFFASK
LLAGRRVLLTAGPTFEAIDPVRGLTNISSGKMGYALARACRDAGAEVTLVSGPTALRTPY
GMQCLNVRSARDMLAAVEAHVAMADVFISVAAVADYRPQVTSEHKLKKTEGGLPSIALTE
NPDILATVAARSDAPFCVGFAAESRDVLGYADEKRRRKNVPLLVANLAQSAMGADDNEVV
LLDDSGQHPLPRMGKPDVARAIVSHLARLL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgacactttcttgttggcgtcacgggcggcgtagccgcttacaaaacctgcgaa
ctggtgcgcctgctggtcaaggcaggtcataccgtcgacgtggtcatgaccgaagcggcc
acccgctttgtcggtccgaccacctttcaggctctctccgggcggccggttttcctcagc
cagtgggatgagcgccccagtaatgccatggcccatatcgagctgacacgccgggcagat
gcgttcctgattgccccggccacggcagacatgctggccaaactggcccacggcctgtgt
gacgatctggtcagtacactggctgccgcccgtacctgcccgctgatcgtggcgccggcc
atgaacaagcagatgtgggacaacccgcccaaccagcggaacgtgacccgcttgcaggct
gacggcgttaccgtgttcggccccggcagtggcgcccaggcctgtggcgaaaccggggat
ggccggatgctggagccggaagacctgttcgacctgttgcagggattttttgccagcaag
ctgctggccggacgccgggtgcttttgactgccggacccaccttcgaagccattgatccg
gtccgggggctgaccaacatctccagcggcaaaatgggttacgcactggctcgtgcctgc
cgggatgccggagccgaggtgacgctggtcagcggcccgacagccctgcgcacgccgtat
ggcatgcaatgcctcaatgtccggtcagcccgcgacatgctggccgcagtcgaagcgcat
gtcgccatggcggacgtgttcatcagcgtggcggccgttgccgactatcgccctcaagtg
accagcgaacacaagctgaaaaaaaccgaaggcggactgccctcgattgcactgaccgaa
aaccccgacatccttgccacggtggctgcccgctccgatgcgccgttctgcgtcggcttt
gccgcagaaagccgtgatgtactgggctatgccgacgaaaaacgccgccgcaagaacgtg
ccgctgctggttgccaacctggcacaaagtgccatgggagcagacgacaacgaagtcgtg
ctgctggatgacagcggccagcatccccttcctcgcatgggcaaacccgatgttgcccgt
gccattgtctcccatctggcccgtctgctctga

DBGET integrated database retrieval system